DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and SOX11

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_003099.1 Gene:SOX11 / 6664 HGNCID:11191 Length:441 Species:Homo sapiens


Alignment Length:464 Identity:128/464 - (27%)
Similarity:181/464 - (39%) Gaps:135/464 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 ESEMDGERSPSHSGHEMTLSMDGIDSSLVFGSARVPVNSSTPYSDATRTKKHSPGHIKRPMNAFM 195
            ||.:..|...:..|..|..|...:|.                 ||....|..| |||||||||||
Human    11 ESNLPREALDTEEGEFMACSPVALDE-----------------SDPDWCKTAS-GHIKRPMNAFM 57

  Fly   196 VWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRPQK 260
            |||::|||||.|::||:|||||||.||:||::|...:|.|:|.|||:||..||.:||:|||||:|
Human    58 VWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRK 122

  Fly   261 KQTRSPGSLKPNQD------------------ADGCEARNDTTNNNNSLTTLAINGTTTAGRKSK 307
            |....| |.||:..                  |.|.:....::.....|...|..|......|:.
Human   123 KPKMDP-SAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKKCGKLKAPAAAGAKAGAGKAA 186

  Fly   308 RS----------------TSTCQSGSASKRLR-------NDSGDTSSKPKYEVKMESAEQLNSAD 349
            :|                .|....|.|.|.::       :|..|...:.:.::|.|..|:...  
Human   187 QSGDYGGAGDDYVLGSLRVSGSGGGGAGKTVKCVFLDEDDDDDDDDDELQLQIKQEPDEEDEE-- 249

  Fly   350 IILPSADNLI---SYQSSEYL--------PLS-TL-SNADCDE--KLHSELSSGPLESRENLSEV 399
               |....|:   ..|.|:.|        |.| || |:|:..|  .|:.|:.:|....       
Human   250 ---PPHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAGATSG------- 304

  Fly   400 VNRFLPLFLGGNEDSQLGVSSLTQSQHNQSDPTAGLMDNISDISPINDREELTEEVMRYLPYLEV 464
                    .||.........::|: ||  ..|.|.     ..:||.:.|...|.           
Human   305 --------AGGGSRLYYSFKNITK-QH--PPPLAQ-----PALSPASSRSVSTS----------- 342

  Fly   465 NPSSDGLTLKVESSSLLGKPLNEPVFDSEDNIVNDANLHSASHQIPPYVPDSHDCFAEDCGGDSS 529
            :.||.|     .||...|:..::.:||...|....|  ||||.|              ..||.::
Human   343 SSSSSG-----SSSGSSGEDADDLMFDLSLNFSQSA--HSASEQ--------------QLGGGAA 386

  Fly   530 SHQVEFEVV 538
            :..:...:|
Human   387 AGNLSLSLV 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 47/70 (67%)
SOX11NP_003099.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 3/9 (33%)
SOX-TCF_HMG-box 48..119 CDD:238684 47/70 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..216 21/100 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..292 15/56 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 319..359 15/63 (24%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000250|UniProtKB:Q7M6Y2 409..441
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148489
Domainoid 1 1.000 109 1.000 Domainoid score I6341
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.