DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and SOX5

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_016875377.1 Gene:SOX5 / 6660 HGNCID:11201 Length:793 Species:Homo sapiens


Alignment Length:434 Identity:114/434 - (26%)
Similarity:162/434 - (37%) Gaps:113/434 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PLSLRPGTVPTVPATTPA---------RPATITIQRRHPAPKADSTP-------------HTLPP 55
            |:.|.|.|:....|.||.         ..|.:...:..|..|....|             || ..
Human   345 PVQLIPTTMAAAAAATPGLGPLQLQQLYAAQLAAMQVSPGGKLPGIPQGNLGAAVSPTSIHT-DK 408

  Fly    56 FSPSPSPASSPSPA-PAQTPGAQKTQSQAAITHPAA-------VASPSAPVAAAAPKTPKTPEPR 112
            .:.||.|.|....| |.......||....:.|.|.:       :.|.:.|:.|:.|....:|..|
Human   409 STNSPPPKSKDEVAQPLNLSAKPKTSDGKSPTSPTSPHMPALRINSGAGPLKASVPAALASPSAR 473

  Fly   113 -STHTHTHTHS----------QHFSPPPRESE-MDG----------------------------- 136
             ||..:.:.|.          |......||.: :||                             
Human   474 VSTIGYLNDHDAVTKAIQEARQMKEQLRREQQVLDGKVAVVNSLGLNNCRTEKEKTTLESLTQQL 538

  Fly   137 ------ERSPSHSGHEMTLSMDGIDSSLVFGSARVPVNSSTPYSDATRTKKHSPGHIKRPMNAFM 195
                  |...||:..:..||.|.      .|||  .|:.|..|.::.....:.| ||||||||||
Human   539 AVKQNEEGKFSHAMMDFNLSGDS------DGSA--GVSESRIYRESRGRGSNEP-HIKRPMNAFM 594

  Fly   196 VWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRPQK 260
            ||::.|||||.:..||:||:.|||.||.||:.::..:||||..|..:|.|.|:.:||:|||:|:.
Human   595 VWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHLEKYPDYKYKPRP 659

  Fly   261 KQT-------RSPGSLKPNQDADGCEARNDTTNNNNSLTTLAINGTTTAGRKSKRSTSTCQSGSA 318
            |:|       ...|..|........|.|........:...:|..|....|       :...:|..
Human   660 KRTCLVDGKKLRIGEYKAIMRNRRQEMRQYFNVGQQAQIPIATAGVVYPG-------AIAMAGMP 717

  Fly   319 SKRLRNDSGDTSSKPK---------YEVKMES---AEQLNSADI 350
            |..|.::....||.|:         |.||.|.   .|::.:.||
Human   718 SPHLPSEHSSVSSSPEPGMPVIQSTYGVKGEEPHIKEEIQAEDI 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 40/70 (57%)
SOX5XP_016875377.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148495
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.