DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and SOX3

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_005625.2 Gene:SOX3 / 6658 HGNCID:11199 Length:446 Species:Homo sapiens


Alignment Length:228 Identity:81/228 - (35%)
Similarity:115/228 - (50%) Gaps:35/228 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RHPAPKADSTPHTLPPFSPSPSPASSPSPAPAQTPGAQKTQSQAAITHPAAVASPSAPVAAAAPK 104
            |.||..|.|...:| ||.|.......||.||        |:||...|    ||:|    |..||.
Human    15 RVPADLARSILISL-PFPPDSLAHRPPSSAP--------TESQGLFT----VAAP----APGAPS 62

  Fly   105 TPKT-----PEPRSTHTHTHTHSQH-FSPPPRESEMDGERSPSHSGHEMTLSMDGIDSSLVFGSA 163
            .|.|     |.| :.::...|..:: ...|.:.:...|..:|..:|.....:..|.:|.   |.:
Human    63 PPATLAHLLPAP-AMYSLLETELKNPVGTPTQAAGTGGPAAPGGAGKSSANAAGGANSG---GGS 123

  Fly   164 RVPVNSSTPYSDATRTKKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLL 228
            ....:.....:|..|        :|||||||||||:.:|||:....|.:||:||||.||..|:||
Human   124 SGGASGGGGGTDQDR--------VKRPMNAFMVWSRGQRRKMALENPKMHNSEISKRLGADWKLL 180

  Fly   229 SKDDKQPYIIEAEKLRKLHMIEYPNYKYRPQKK 261
            :..:|:|:|.||::||.:||.|||:|||||::|
Human   181 TDAEKRPFIDEAKRLRAVHMKEYPDYKYRPRRK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 40/70 (57%)
SOX3NP_005625.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..48 8/26 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..140 9/63 (14%)
SOX-TCF_HMG-box 138..209 CDD:238684 41/78 (53%)
SOXp 208..302 CDD:289133 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148444
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.