DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and SOX1

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_005977.2 Gene:SOX1 / 6656 HGNCID:11189 Length:391 Species:Homo sapiens


Alignment Length:112 Identity:50/112 - (44%)
Similarity:72/112 - (64%) Gaps:11/112 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 GSARVPVNSSTPY-----------SDATRTKKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHN 214
            |.|:.|.|.|.|.           .......|.:...:|||||||||||:.:|||:.:..|.:||
Human    14 GGAQAPTNLSGPAGAGGGGGGGGGGGGGGGAKANQDRVKRPMNAFMVWSRGQRRKMAQENPKMHN 78

  Fly   215 AEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRPQKK 261
            :||||.||..|:::|:.:|:|:|.||::||.|||.|:|:|||||::|
Human    79 SEISKRLGAEWKVMSEAEKRPFIDEAKRLRALHMKEHPDYKYRPRRK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 39/70 (56%)
SOX1NP_005977.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 7/37 (19%)
SOX-TCF_HMG-box 50..121 CDD:238684 39/70 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.