DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and sox19b

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_571777.1 Gene:sox19b / 64812 ZFINID:ZDB-GENE-010111-1 Length:293 Species:Danio rerio


Alignment Length:345 Identity:96/345 - (27%)
Similarity:144/345 - (41%) Gaps:105/345 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 KTPEPRSTHTHTHTHSQHFSPPPRESEMDGERSPSHSGHEMTLSMDGIDSSLVFGSARVPVNSST 171
            ||..|    .||..||...|||.     .|..:..|.  ..|....|:|          |::.  
Zfish    11 KTAGP----PHTLQHSPGMSPPG-----SGVGNAHHV--SKTACPPGVD----------PMDK-- 52

  Fly   172 PYSDATRTKKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPY 236
                           :|||||||||||:.:|||:.:..|.:||:||||.||..|:||:..:|:|:
Zfish    53 ---------------VKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLTDVEKRPF 102

  Fly   237 IIEAEKLRKLHMIEYPNYKYRPQKKQTRSPGSLKPNQDADGCEARNDTTNNNNSLTTLAINGTTT 301
            |.||::||.:||.|||:|||:|::| |::                  ....:||:....:    .
Zfish   103 IDEAKRLRAVHMKEYPDYKYKPRRK-TKA------------------LMKKDNSVGKYPL----A 144

  Fly   302 AGRKSKRSTSTCQSGSASKRLRND-------------SGDTSSKP----KYEVKMESAEQLNSAD 349
            ||.....:.:..|.||.    |.|             .||....|    :|::   ||.|..:|.
Zfish   145 AGNLLASAVAQGQGGSP----RMDGYGWGHAGGYMGMQGDALGYPQQLHRYDL---SALQYPAAQ 202

  Fly   350 IILPSADNL--ISYQSSEYLPLSTLSNADCDEKLHSELSSGPLESR----ENLSEVVNRFLPLFL 408
            ..:.||.:.  :||.||...|...:|....:...||. :..|...|    .:|.::::.::|   
Zfish   203 PYMNSASSYSQMSYSSSPQQPSPVMSMVKPEPLSHSP-TGVPNHHRGAFQGDLRDMISMYIP--- 263

  Fly   409 GGNEDSQLGVSSLTQSQHNQ 428
            ||:          |....||
Zfish   264 GGD----------TSESSNQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 40/70 (57%)
sox19bNP_571777.1 SOX-TCF_HMG-box 52..123 CDD:238684 40/87 (46%)
SOXp 122..203 CDD:289133 21/110 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582332
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.