DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and PDLIM2

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_067643.3 Gene:PDLIM2 / 64236 HGNCID:13992 Length:602 Species:Homo sapiens


Alignment Length:511 Identity:110/511 - (21%)
Similarity:160/511 - (31%) Gaps:150/511 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSLRPGT--VPTVPATTPARPATITIQRRHPA-PKADSTPHTLPPFSPSPSPASSPSPAPAQTPG 75
            |...||:  :...|....|.||    .|..|| ...||.||  ||....|..::          .
Human    33 LCCAPGSRGLAGAPGRMRAPPA----GRSQPAGGPGDSLPH--PPGGLGPGGSA----------W 81

  Fly    76 AQKTQSQAAITHPAAVASPSAPVAAAAPKTPKTPEPRSTHTHTHTHSQHFSPPPR--ESEMDGER 138
            |::.::.|:.........|....|.|.|..|....|.|.............||.|  .....|||
Human    82 ARRAEAAASRARGGGRGGPGITWAEAGPGAPGGLSPESGRRQRERWRLPAFPPSRAWAPSRTGER 146

  Fly   139 SPSHSGH-----EMTLSMDGIDSSLVFGSARVP--VNSSTPYSDATRTKKHSPGHIKRPMNAFMV 196
            .|....|     ...|...|:.|:.:  |||.|  |....|:|.|:...  .|.....|..|.::
Human   147 QPGERAHLRLSARPALPGAGLLSAPL--SARNPGLVRGPAPWSLASAGA--PPRAALSPAGALLL 207

  Fly   197 WSQMERRKICERTP--------------------------------------------------- 210
             ....||.:|.|:.                                                   
Human   208 -QPPARRVLCPRSEGGSRTGRAGPSGWAPPRGARSAESTDRLKGMALTVDVAGPAPWGFRITGGR 271

  Fly   211 DLHNAEISKELGRRWQLLSKD-DKQP-------------YIIEAEKLRKLHMIEYPNYKYRPQKK 261
            |.|...:..::..|.:  :|| |.:|             .::.||...|:.....| .:.:..:.
Human   272 DFHTPIMVTKVAERGK--AKDADLRPGDIIVAINGESAEGMLHAEAQSKIRQSPSP-LRLQLDRS 333

  Fly   262 QTRSPGSLKPNQDADGCEARNDTTNNNNSLTTLAIN-----GTTTAGRKSKRSTSTCQSGSASKR 321
            |..|||.                ||.::||..||..     .|.|..:.|.||     |.|:...
Human   334 QATSPGQ----------------TNGDSSLEVLATRFQGSVRTYTESQSSLRS-----SYSSPTS 377

  Fly   322 LRNDSGDTSSKPKY------EVKMESAEQLNSADIILPSADNLISYQSSEYLPLSTLSNADCDEK 380
            |...:|...|.|..      |..:..:.|..:....||:||.| ||........:.|..|.....
Human   378 LSPRAGSPFSPPPSSSSLTGEAAISRSFQSLACSPGLPAADRL-SYSGRPGSRQAGLGRAGDSAV 441

  Fly   381 LHSELSSGPLESRENL-SEVVNRFLPLFLGG----NEDSQLGVSSLTQSQHNQSDP 431
            |....|.||..||.:: ||          ||    :|||:: ...|.:::..::.|
Human   442 LVLPPSPGPRSSRPSMDSE----------GGSLLLDEDSEV-FKMLQENREGRAAP 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 17/135 (13%)
PDLIM2NP_067643.3 PDZ_signaling 259..330 CDD:238492 11/73 (15%)
DUF4749 <462..505 CDD:292558 6/26 (23%)
LIM_Mystique 536..588 CDD:188833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.