DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and sox9b

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_571719.1 Gene:sox9b / 60642 ZFINID:ZDB-GENE-001103-2 Length:407 Species:Danio rerio


Alignment Length:502 Identity:112/502 - (22%)
Similarity:184/502 - (36%) Gaps:177/502 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SPSPSPASSPSPAPAQTPGAQKTQSQAAITHPAAVASPSAPVAAAAPKTPKTPEPRSTHTHTHTH 121
            :||||.:...:.:|..:.|                       :.:..:||:.             
Zfish    15 APSPSLSEDSAGSPCASAG-----------------------SGSDSETPRA------------- 43

  Fly   122 SQHFSPPPRESEMDGERSPSHSGHEMTLSMDGIDSSLVFGSARVPVNSSTPYSDATRTKKHSPGH 186
                .||....|.  |:.|......::..:.|.|.|||    .:||..|       .:.|..| |
Zfish    44 ----EPPLHRDEQ--EKFPVCIRDAVSQVLKGYDWSLV----PMPVRVS-------GSGKSKP-H 90

  Fly   187 IKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEY 251
            :||||||||||:|..|||:.::.|.|||||:||.||:.|:||::.:|:|::.|||:||..|..::
Zfish    91 VKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNEGEKRPFVEEAERLRVQHKKDH 155

  Fly   252 PNYKYRPQKKQTRSPGSLKPNQDADGCEARNDTTNNNNSLTTLAINGTTTAGRKSKR-STSTCQS 315
            |:|||:|:::::...||.   :..||            ..|.::.|....|.::::. .:||.:.
Zfish   156 PDYKYQPRRRKSVKSGSA---ESEDG------------EQTQISTNALFRALQRAETPDSSTGEL 205

  Fly   316 GSASKRLRNDSGDTS--SKPKYEVKMESAEQLN-------------------------SADIILP 353
            .|..:......|..:  :.||.::.:.|...|.                         |:|:|  
Zfish   206 HSPGEHSGQSQGPPTPPTTPKTDLPVCSKADLKRERERDRERPLQDGIDFGAVDIGELSSDVI-- 268

  Fly   354 SADNLISYQSSE---YLP---------LSTLSNADCDEKLHSELSSGPLESRENLSEVVNRFLPL 406
              .|:.::..:|   |||         ....|.......:|..|:|   .|..|..|        
Zfish   269 --SNIEAFDVNEFDQYLPPHGAPGPAGAGFSSGYGSAAWMHKPLAS---SSMANAGE-------- 320

  Fly   407 FLGGNEDSQLGVSSLTQSQHNQSDPTAGLMDNISDISPINDREELTE----EVMRYLPYLEVNPS 467
              ...:.:|:....|:...::|..|......     :|.: |.:.||    ....|.||      
Zfish   321 --QHQQRAQIKTEQLSPGHYSQQPPQQQFYS-----APYS-RAQYTEYSEQHSAYYSPY------ 371

  Fly   468 SDGLTLKVESSSLLGKPLNEPVFDSEDNIVNDANLHSASHQIPPYVP 514
                                |.|               |:..|||.|
Zfish   372 --------------------PTF---------------SYSRPPYTP 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 39/70 (56%)
sox9bNP_571719.1 Sox_N 16..80 CDD:372113 19/109 (17%)
SOX-TCF_HMG-box 90..160 CDD:238684 38/69 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582345
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.