DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and sox5

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_021330769.1 Gene:sox5 / 567413 ZFINID:ZDB-GENE-000607-13 Length:763 Species:Danio rerio


Alignment Length:481 Identity:120/481 - (24%)
Similarity:177/481 - (36%) Gaps:170/481 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KPNQATTEP-PLSLRPGTVPTVPATTP------------ARPATITIQ---RRHPAPKADSTPHT 52
            ||  ..:|| ||.|.|.|:....|.||            |:.|.:.:.   :....|:|:....|
Zfish   303 KP--GCSEPYPLQLIPTTMAAAAAATPGLGPLQLQQLYAAQLAAMQVSPGAKHSTVPQANLATGT 365

  Fly    53 LPPFS-PSPSPASSPSPAP----------AQTPGAQKTQSQAAITHPAAVASPSAPVAAAAPKTP 106
            |.|.| .|....|:|.|.|          :..|.|.:::|      |.:.|||..|.....|.:.
Zfish   366 LSPTSGQSEKNRSTPPPKPKDEGAQPLNLSSKPKASESKS------PTSPASPQVPALKLGPGSL 424

  Fly   107 KTPEPRSTHTHTHTHSQHFSPPPRESEMDGERSPSHSG----HEM-------------------- 147
            |...|.|..          .||.|.|.:|...|.:.:|    ||.                    
Zfish   425 KHSAPSSIG----------GPPSRLSSIDLLSSITSAGYLNDHEAVTKAFQEARKMKEQLKREEQ 479

  Fly   148 ----------TLSMDGIDSSLV-----------------------------FG-----SARVPVN 168
                      :||::...|..|                             ||     .....|:
Zfish   480 VLDAKVAAVNSLSLNNGRSEKVRFMEKAALESLSQQLKQSEESKFTHAMMDFGISGDSDGSPSVS 544

  Fly   169 SSTPYSDATRTKKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDK 233
            .|..:.:| |.:..|..||||||||||||::.|||||.:..||:||:.|||.||.||:.::..:|
Zfish   545 DSRIFREA-RGRGSSEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMTNLEK 608

  Fly   234 QPYIIEAEKLRKLHMIEYPNYKYRPQKKQTRSPGSLKPNQDADGCEARNDTTNNNNSLTTLAING 298
            |||..|..:|.|.|:.:||:|||:|:.|:|              |                    
Zfish   609 QPYYEEQARLSKQHLEKYPDYKYKPRPKRT--------------C-------------------- 639

  Fly   299 TTTAGRKSKRSTSTCQSGSASKRLRNDSGDTSSKPKYEVKMESAEQLNSADIILPSADNLISYQS 363
             ...|:|       .:.|.....:||...:  .:..:.|..::...|:||.::.|.|.::....|
Zfish   640 -LVDGKK-------LRIGEYKAIMRNRRQE--MRQYFTVGQQAQLPLSSAGVVYPGALSMAGMPS 694

  Fly   364 SEYLPLSTLSNADCDEKLHSELSSGP 389
            .: :|..           ||.:||.|
Zfish   695 PQ-MPSE-----------HSSMSSSP 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 40/70 (57%)
sox5XP_021330769.1 SSL_OB 332..>415 CDD:332684 20/88 (23%)
SOX-TCF_HMG-box 561..632 CDD:238684 40/70 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582394
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.