DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and pdlim3b

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_005157291.1 Gene:pdlim3b / 561865 ZFINID:ZDB-GENE-060130-104 Length:332 Species:Danio rerio


Alignment Length:279 Identity:64/279 - (22%)
Similarity:105/279 - (37%) Gaps:59/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PRESEMDGERSPSHSGHEMTLSMDGIDSSLVFGSARVPVNSSTPYSDATRTKKHSPGHIKRPMNA 193
            |:...:||   |:..|..::   .|.|.:......||     ||.|.|:|... .||.|...:..
Zfish     2 PQNVVLDG---PAPWGFRLS---GGKDFNQPLTITRV-----TPGSKASRVNL-CPGDIILSIQG 54

  Fly   194 F----MVWSQMERRKICERTPDLHNAEISKELGRRW--QLLSKDDKQPYII--EAEKLRKLHMIE 250
            .    |..::.: ..|.:.|..|. .:|.:...:.|  |::.:....|:.|  ||||    ..|:
Zfish    55 VSTDGMTHAEAQ-NNIKDSTNQLF-LKIERPETKIWSPQVIEEGKVNPFKINLEAEK----QDID 113

  Fly   251 YPNYKYRPQKKQTRSPGSLKPNQDADGCEARNDTTNNNNSLTTLAINGTTTAGRKSKRSTSTCQS 315
            |..:|:..:.|...|            ...|:|:|:.     ||..|....||     :.||..|
Zfish   114 YFEHKFNVRPKPFTS------------ASQRSDSTSQ-----TLMGNVAQMAG-----TPSTAHS 156

  Fly   316 GSASKRLRNDSGDTSSKPKYEVKMESAEQLNSADIILPSADNLISYQSSE-YLPLSTLSNADCDE 379
            ...:..:...|.|..|....:.:|.:..:..|     ||:..|.|.:.|. |..|.     |.:|
Zfish   157 VQYNSPVALYSADNVSNTLQQAQMSTVVRQAS-----PSSKPLTSIEDSHVYRMLQ-----DANE 211

  Fly   380 KLHSELSSGPLESRENLSE 398
            :.|....||..::.::..|
Zfish   212 QPHEPRQSGSFKALQDYVE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 17/78 (22%)
pdlim3bXP_005157291.1 PDZ_signaling 2..81 CDD:238492 21/92 (23%)
DUF4749 156..232 CDD:292558 19/85 (22%)
LIM_ALP 262..314 CDD:188834
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.