DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and lpxn

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_689239.4 Gene:lpxn / 560743 ZFINID:ZDB-GENE-081105-159 Length:405 Species:Danio rerio


Alignment Length:163 Identity:37/163 - (22%)
Similarity:54/163 - (33%) Gaps:63/163 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DSTPHTLPPFSPSPSPASSPS---PAPA----QTPGAQKTQSQAAITHPAAV-----ASPSAPVA 99
            |.....|...:.:.|.||.|.   ||..    .|...|:|:|.:.|..|...     :.|:|||.
Zfish     2 DELDMLLEQLAQNSSEASDPPVLLPAKTLKNNNTTVLQQTESSSLIAGPRQTFDNPYSVPTAPVE 66

  Fly   100 AA--APKTP------------------KTPEPRSTHTHTHTHSQHFSPPP--RES---------- 132
            |:  :|:|.                  ..|.|.|            :|||  |:|          
Zfish    67 ASLMSPRTATRELDSLMNDLLGLDLEVSEPAPSS------------NPPPLARKSIKAKTTEETG 119

  Fly   133 -----EMDGERSPSHS--GHEMTLSMDGIDSSL 158
                 ..:|:|.|.|.  ..:.:..:|.||..|
Zfish   120 ESGSGRQEGDRKPQHPPLSEKFSKGVDAIDDLL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684
lpxnXP_689239.4 LIM1_Paxillin_like 172..224 CDD:259830
LIM2_Leupaxin 231..282 CDD:188792
LIM3_Leupaxin 290..342 CDD:188794
LIM4_Leupaxin 349..400 CDD:188796
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.