DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and sox13

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001352418.1 Gene:sox13 / 555983 ZFINID:ZDB-GENE-100519-1 Length:597 Species:Danio rerio


Alignment Length:292 Identity:82/292 - (28%)
Similarity:125/292 - (42%) Gaps:70/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AKPNQATTEPPLSLRPGTVPTVPATTP------------------------ARPATITIQRRHPA 43
            |:|...|:|..:.|....:|..|...|                        ::|..:|.:.:.|:
Zfish   233 AQPLPVTSEAQMGLPLQPIPCKPVEYPMQLLPNPHSTPVKRSSGTVYRQDTSQPLNLTAKPKTPS 297

  Fly    44 PKADSTPHTLPPFSPSPSPASSPSPAPAQT---PGAQKTQSQAAITHPAAVASPSAPVAAAAPKT 105
            |:|....|....:.....|.|.|..|.:.:   .|...||:    .|.|.........:....:.
Zfish   298 PQALELAHLQSGYRHRDLPQSPPRSALSLSFLGEGDVVTQA----IHDAQQLLRGGQSSTGRERD 358

  Fly   106 PKT----PEPRSTHTHTHTHSQHFSPPPRESEMDGERSPSHSGHEMTLSMDGIDSSLVFGSARVP 166
            ..|    ...|....|:.|:..|.|     |:.:|:           :::.|:.|   ||.:|.|
Zfish   359 NNTRLEASRDRMDDGHSRTNEDHHS-----SDSEGQ-----------MAISGVGS---FGESRTP 404

  Fly   167 VNSSTPYSDATRTKKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKD 231
                            |.|||||||||||||::.|||:|.:..||:||:.|||.||.||:.:|..
Zfish   405 ----------------SSGHIKRPMNAFMVWAKDERRRILQAFPDMHNSSISKILGSRWKSMSNQ 453

  Fly   232 DKQPYIIEAEKLRKLHMIEYPNYKYRPQKKQT 263
            :||||..|..:|.:.|:..||:|||:|:.|:|
Zfish   454 EKQPYYEEQARLSRQHLERYPDYKYKPRPKRT 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 39/70 (56%)
sox13NP_001352418.1 SOX-TCF_HMG-box 408..479 CDD:238684 39/70 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582374
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.