DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and pdlim3a

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001019547.1 Gene:pdlim3a / 554148 ZFINID:ZDB-GENE-050505-1 Length:307 Species:Danio rerio


Alignment Length:270 Identity:60/270 - (22%)
Similarity:97/270 - (35%) Gaps:90/270 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 GSASKRLRNDSGDTSSKPKYEVKME-----SAEQLNSADIILP----SADNLI-----------S 360
            |.|....|...|...|:|....|:.     |...|:..||||.    ||:||:           |
Zfish     9 GPAPWGFRLIGGRDFSQPLTVAKISPGSKASTVNLSPGDIILSIDGVSAENLMHSEAQTLIKDAS 73

  Fly   361 YQ---------SSEYLPLST-----LSNADCDEKLHSELSSG------PL-------ESRENLSE 398
            ||         :..:.|..|     ..|.:.:.:.|..:.:|      |.       |:|:.:|.
Zfish    74 YQLTLTVERPETKLWSPNMTEDNPFKMNLEAERQEHRPIGAGHNRRASPFVAAANIDETRQVVSP 138

  Fly   399 VVNRFLPLFLGGN-EDSQLGVSSLTQSQHNQSD-PTAGLMDNISDISPINDREELTEEVMRYLP- 460
            ..|..:.|:..|| :|:..|  .|....||::: ||.  :.||.|.......::..||...:.| 
Zfish   139 TYNSPIGLYSSGNIQDALQG--QLKGLIHNKAESPTK--LSNIEDSDVYRMLQKNQEEDEAHEPR 199

  Fly   461 ------YLEVNPSSDG----LTLKVESSSLLGKPLNEPVFDSEDNIVNDANLHSASHQIPPYVPD 515
                  .|:...:|:|    :..||.:      |:::|...|       .||    |::|     
Zfish   200 QSGSFKALQSFMNSEGTRPLVIRKVHA------PMSKPSAPS-------GNL----HKLP----- 242

  Fly   516 SHDCFAEDCG 525
                ..:.||
Zfish   243 ----MCDKCG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684
pdlim3aNP_001019547.1 PDZ_signaling 2..81 CDD:238492 20/71 (28%)
DUF4749 134..214 CDD:292558 19/83 (23%)
LIM_ALP_like 244..295 CDD:188746 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.