DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and SOX18

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_060889.1 Gene:SOX18 / 54345 HGNCID:11194 Length:384 Species:Homo sapiens


Alignment Length:222 Identity:77/222 - (34%)
Similarity:110/222 - (49%) Gaps:62/222 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SPSPSPASSPSPAP---AQTPG---AQKTQSQAAITHPAAVASPSAPVAAAAPKTPKTPEPRSTH 115
            ||....|....||.   |..||   |..|:..||  .|||:|:|:||   |:|.:|:...||   
Human     4 SPPGYGAQDDPPARRDCAWAPGHGAAADTRGLAA--GPAALAAPAAP---ASPPSPQRSPPR--- 60

  Fly   116 THTHTHSQHFSPPPRESEMDGERSPSHSGHEMTLSMDGIDSSLVFGSARVPVNSSTPYSDATRTK 180
                      ||.|....:    ||:..|....                         :|.:|  
Human    61 ----------SPEPGRYGL----SPAGRGERQA-------------------------ADESR-- 84

  Fly   181 KHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRK 245
                  |:|||||||||::.||:::.::.||||||.:||.||:.|:.|:..:|:|::.|||:||.
Human    85 ------IRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNAAEKRPFVEEAERLRV 143

  Fly   246 LHMIEYPNYKYRP-QKKQTRSPGSLKP 271
            .|:.::||||||| :|||.|....|:|
Human   144 QHLRDHPNYKYRPRRKKQARKARRLEP 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 36/70 (51%)
SOX18NP_060889.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88 33/138 (24%)
SOX-TCF_HMG-box 84..155 CDD:238684 37/78 (47%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 87..100 9/12 (75%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 111..123 7/11 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..218 13/25 (52%)
Important for transcriptional activation. /evidence=ECO:0000250|UniProtKB:P43680 166..231 2/5 (40%)
Sox_C_TAD 193..382 CDD:288887
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148450
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.