DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Pdlim1

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_059061.1 Gene:Pdlim1 / 54133 RGDID:68324 Length:327 Species:Rattus norvegicus


Alignment Length:180 Identity:35/180 - (19%)
Similarity:54/180 - (30%) Gaps:61/180 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TITIQR---------------RHP-----APKADSTPH-------TLPPFSPSPSPASSPSPAPA 71
            |:|:.|               |||     |.:.....|       :..||:.||:|.:.......
  Rat    78 TLTVSRSEQKIWSPLVTEEGKRHPYKMNLASEPQEVLHIGSAHNRSAMPFTASPAPGTRVITNQY 142

  Fly    72 QTPGAQKTQSQAAITHPAAVASPSAPVAAAAPKTPKTPEP--------RSTHTHTHTHSQHFSPP 128
            .:|....:....:..:.|..:..||....|..:....|.|        .|.........|..:.|
  Rat   143 NSPTGLYSSENISNFNNAVESKTSASGEEANSRPSAQPHPSGGLIIDKESEVYKMLQEKQELNEP 207

  Fly   129 PRES----------EMDGERSPSH-SGHEMTLSMDGIDSSLVFGSARVPV 167
            |::|          |.||:..|:. ||               |.|.:.||
  Rat   208 PKQSTSFLVLQEILESDGKGDPNKPSG---------------FRSVKAPV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684
Pdlim1NP_059061.1 PDZ_signaling 5..81 CDD:238492 1/2 (50%)
DUF4749 136..228 CDD:292558 15/91 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..186 5/24 (21%)
LIM_CLP36 258..309 CDD:188832
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.