Sequence 1: | NP_001286801.1 | Gene: | Sox14 / 37822 | FlyBaseID: | FBgn0005612 | Length: | 669 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_058557.2 | Gene: | Pdlim1 / 54132 | MGIID: | 1860611 | Length: | 327 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 45/200 - (22%) |
---|---|---|---|
Similarity: | 73/200 - (36%) | Gaps: | 50/200 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 325 DSGDTSSKPKYEVKMESAEQLNSADIILPSADNLISYQSSEYLPLSTLSNADCDEKLHSELSSGP 389
Fly 390 LESRE--------NLSEVVNRFLPLFLGGNEDSQLGVSSLTQSQH---NQSDPTAGL--MDNISD 441
Fly 442 I-SPINDREELTEEVMRYLPYLEVNPSSDGLTLKVESSSLLGK------PLNEPVFDSEDNIVND 499
Fly 500 ANLHS 504 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sox14 | NP_001286801.1 | SOX-TCF_HMG-box | 186..257 | CDD:238684 | |
Pdlim1 | NP_058557.2 | PDZ_signaling | 5..81 | CDD:238492 | 12/48 (25%) |
DUF4749 | 136..228 | CDD:292558 | 21/90 (23%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 161..184 | 3/22 (14%) | |||
LIM_CLP36 | 258..309 | CDD:188832 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1703 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |