DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and sox3

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001007502.1 Gene:sox3 / 493228 XenbaseID:XB-GENE-484815 Length:307 Species:Xenopus tropicalis


Alignment Length:304 Identity:95/304 - (31%)
Similarity:142/304 - (46%) Gaps:59/304 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 VNSSTPYSDATRTKKHSPG-----------HIKRPMNAFMVWSQMERRKICERTPDLHNAEISKE 220
            :.|....|:|......:||           .:|||||||||||:.:|||:.:..|.:||:||||.
 Frog     9 LKSPVQQSNAPNGGPGTPGGKGNASIPDQERVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKR 73

  Fly   221 LGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRPQKKQTRS---------PGSL-----KP 271
            ||..|:|||..:|:|:|.||::||.:||.|||:|||||::| |::         ||:|     .|
 Frog    74 LGADWKLLSDSEKRPFIDEAKRLRAVHMKEYPDYKYRPRRK-TKTLLKKDKYSLPGNLLAPGVSP 137

  Fly   272 NQDADGCEARNDT-------TNNNNSLTTLAINGTTTAGRKSKRSTSTCQSGSASKRLRNDSGDT 329
            ...:.|...|.||       ||...||....:..:...|..|.:....        :.|.|.|..
 Frog   138 VASSVGVGQRIDTYAHMNGWTNGAYSLMQDQLGYSQHPGMNSPQMQQI--------QHRYDMGGL 194

  Fly   330 SSKPKYEVKMESAEQLNSADIILPSADNLISYQSSEYLPLSTLSNADCDEKLHSELSSGP--LES 392
                :|...|.||:...:|.....|.....:.|||..:.|.::.:.     :.||.||.|  :.|
 Frog   195 ----QYSPMMSSAQTYMNAAASTYSMSPAYNQQSSTVMSLGSMGSV-----VKSEPSSPPPAITS 250

  Fly   393 RE------NLSEVVNRFLPLFLGGNEDSQLGVSSL-TQSQHNQS 429
            ..      :|.::::.:||.....::.|.|..|.| :..||.||
 Frog   251 HTQRACLGDLRDMISMYLPPGGDASDPSSLQSSRLHSVHQHYQS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 41/70 (59%)
sox3NP_001007502.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 5/31 (16%)
SOX-TCF_HMG-box 39..110 CDD:238684 41/70 (59%)
SOXp 109..189 CDD:372055 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.