DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and hmgb3

DIOPT Version :10

Sequence 1:NP_476894.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001004888.1 Gene:hmgb3 / 448228 XenbaseID:XB-GENE-1002014 Length:202 Species:Xenopus tropicalis


Alignment Length:117 Identity:31/117 - (26%)
Similarity:55/117 - (47%) Gaps:7/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLR 244
            ||..|...|||.:.|.::....|.||....|.:...:::|:||..|..|:..:||||..:|.||:
 Frog    86 KKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDGEKQPYNNKAAKLK 150

  Fly   245 KLHMIEYPNYKYRPQ-------KKQTRSPGSLKPNQDADGCEARNDTTNNNN 289
            :.:..:..:||.:.:       .|..|.....:.:.|.|..|...|..::::
 Frog   151 EKYEKDVADYKSKGKFDCAKGAPKLARKKEEDEDDDDEDEEEDEEDEEDDDD 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_476894.1 HMG-box_SoxC 186..261 CDD:438838 22/81 (27%)
hmgb3NP_001004888.1 HMG-box_HMGB_rpt1 13..76 CDD:438794
HMG-box_HMGB_rpt2 91..161 CDD:438795 20/69 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.