DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and sox1a

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001002483.1 Gene:sox1a / 436756 ZFINID:ZDB-GENE-040718-186 Length:336 Species:Danio rerio


Alignment Length:347 Identity:88/347 - (25%)
Similarity:138/347 - (39%) Gaps:105/347 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 YSDATRTKKHSPG---------------------HIKRPMNAFMVWSQMERRKICERTPDLHNAE 216
            ||....|..||||                     .:|||||||||||:.:|||:.:..|.:||:|
Zfish     2 YSMMMETDLHSPGPQTNTNPGQTGPNSGSKANQDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSE 66

  Fly   217 ISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRPQKK-------------------- 261
            |||.||..|:::|:.:|:|:|.||::||.:||.|:|:|||||::|                    
Zfish    67 ISKRLGAEWKVMSEAEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKTKTLLKKDKYSLAGGLLGGA 131

  Fly   262 -------------QTRSPGSLKPNQDADGCEARNDTTNNNNSLTTLAINGTTTAGRKSKRSTSTC 313
                         :..|||....:..| |....|...|...|....|........::::.:.|. 
Zfish   132 GGGVGMSPAGVGQRLESPGGHGSSASA-GYAHMNGWANGTYSGQVAAAAAAAAMMQEAQLAYSQ- 194

  Fly   314 QSGSASKR--------------------------LRNDSGDTSSKPKYEVKMESAEQLNSADIIL 352
            ..||.|..                          :.|.....|:.|.....:...:..||: :..
Zfish   195 HPGSGSHHHHAHHHHPHNPQPMHRYDMTALQYSPISNSQSYMSASPSGYGGISYTQHQNSS-VAT 258

  Fly   353 PSA----DNLISYQSSEYLPLSTLSNADCDEKLHSELSSGPLESRENLSEVVNRFLPLFLGGNED 413
            |:|    .:|:..:.:...|::|.|...|.               .:|.|:::.:||....|:..
Zfish   259 PAAIGTLSSLVKSEPNISPPVTTHSRGPCP---------------GDLREMISMYLPTGESGDPS 308

  Fly   414 SQLGVSSLTQSQHNQSDPTAGL 435
            .|..:.:|  .||.|| .|||:
Zfish   309 VQSRLHAL--PQHYQS-TTAGV 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 38/70 (54%)
sox1aNP_001002483.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 7/36 (19%)
SOX-TCF_HMG-box 36..107 CDD:238684 38/70 (54%)
SOXp 106..>194 CDD:289133 13/88 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..216 4/23 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.