DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and sox2

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_998869.1 Gene:sox2 / 407873 XenbaseID:XB-GENE-484553 Length:311 Species:Xenopus tropicalis


Alignment Length:303 Identity:96/303 - (31%)
Similarity:137/303 - (45%) Gaps:61/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 SDATRTKKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYII 238
            |.:....|:||..:|||||||||||:.:|||:.:..|.:||:||||.||..|:|||:.:|:|:|.
 Frog    24 SGSNNQSKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPFID 88

  Fly   239 EAEKLRKLHMIEYPNYKYRPQK---------KQTRSPGSLKP--NQDADGCEARNDTTNNNNSLT 292
            ||::||.|||.|:|:|||||::         |.|...|.|.|  |....|..|......|....|
 Frog    89 EAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGANPMTSGVGASLGAGVNQRMDT 153

  Fly   293 TLAINGTTTAG---------------------------RKSKRSTSTCQSGSASKRLRNDSGDTS 330
            ...:||.|..|                           .:...|.....|.|:|:...|.|    
 Frog   154 YAHMNGWTNGGYGMMQEQLGYPQHPGLSAHNAPQMQPMHRYDVSALQYNSMSSSQTYMNGS---- 214

  Fly   331 SKPKYEVKMESAEQLNSADIILPSADNLISYQSSEYLPLSTLSNADCDEKLHSELSSGPLESREN 395
              |.|.:   |..|..:..:.|.|..:::..:||...|:.|.|:       ||.   .|.::.: 
 Frog   215 --PTYSM---SYSQQGAPGMSLGSMGSVVKSESSSSPPVVTSSS-------HSR---APCQAGD- 263

  Fly   396 LSEVVNRFLPLFLGGNEDSQLGVSSLTQSQHNQSDPTAGLMDN 438
            |.::::.:||   |.........|.|..|||.||...||...|
 Frog   264 LRDMISMYLP---GAEVPEPAAQSRLHMSQHYQSASVAGTAIN 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 41/70 (59%)
sox2NP_998869.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 5/15 (33%)
SOX-TCF_HMG-box 36..107 CDD:238684 41/70 (59%)
SOXp 106..194 CDD:372055 17/87 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..259 8/36 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.