DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and sox2

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_998283.1 Gene:sox2 / 378723 ZFINID:ZDB-GENE-030909-1 Length:315 Species:Danio rerio


Alignment Length:297 Identity:94/297 - (31%)
Similarity:138/297 - (46%) Gaps:58/297 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLR 244
            :|:||..||||||||||||:.:|||:.:..|.:||:||||.||..|:|||:.:|:|:|.||::||
Zfish    31 QKNSPDRIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSESEKRPFIDEAKRLR 95

  Fly   245 KLHMIEYPNYKYRPQK---------KQTRSPGSLKP-------------------NQDADGCEAR 281
            .|||.|:|:|||||::         |.|...|.|.|                   ||..|.....
Zfish    96 ALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNGMGAGVGVGAGLGAGVNQRMDSYAHM 160

  Fly   282 NDTTNNNNSL----------TTLAINGTTTAGRKSKRSTSTCQSGSASKRLRNDSGDTSSKPKYE 336
            |..||....:          .:|..:.|.......:...|..|..|    :.|.....:..|.|.
Zfish   161 NGWTNGGYGMMQEQLGYPQHPSLNAHNTAQMQPMHRYDMSALQYNS----MTNSQTYMNGSPTYS 221

  Fly   337 VKMESAEQLNSADIILPSADNLISYQSSEYLPLSTLSNADCDEKLHSELSSGPLESRENLSEVVN 401
            :   |..|.::..:.|.|..:::..:||...|:.|.|:       ||.  :|..::.: |.::::
Zfish   222 M---SYSQQSTPGMTLGSMGSVVKSESSSSPPVVTSSS-------HSR--AGQCQTGD-LRDMIS 273

  Fly   402 RFLPLFLGGNEDSQLGVSSLTQSQHNQSDPTAGLMDN 438
            .:||   |.....|...|.|..|||.||.|..|...|
Zfish   274 MYLP---GAEVQDQSAQSRLHMSQHYQSAPVPGTTIN 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 42/70 (60%)
sox2NP_998283.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 5/9 (56%)
SOX-TCF_HMG-box 37..108 CDD:238684 42/70 (60%)
SOXp 107..197 CDD:289133 16/89 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 235..263 9/36 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..315 5/12 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582397
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.