DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and CG34325

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001097003.1 Gene:CG34325 / 32656 FlyBaseID:FBgn0085354 Length:179 Species:Drosophila melanogaster


Alignment Length:43 Identity:13/43 - (30%)
Similarity:20/43 - (46%) Gaps:4/43 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 ERRKICERTPDLHNAEISKELGRRW---QLLSKDDKQPYIIEA 240
            |:..||.:..::....|...||:.|   ..:.||.:.| |.||
  Fly     3 EQPSICHKCNEVIQLRIITALGKTWHPEHFVCKDCQCP-ITEA 44

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 13/43 (30%)
CG34325NP_001097003.1 LIM 8..59 CDD:295319 11/38 (29%)
LIM 67..119 CDD:295319
LIM 127..175 CDD:295319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.