powered by:
Protein Alignment Sox14 and CG31988
DIOPT Version :9
Sequence 1: | NP_001286801.1 |
Gene: | Sox14 / 37822 |
FlyBaseID: | FBgn0005612 |
Length: | 669 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001286122.1 |
Gene: | CG31988 / 326182 |
FlyBaseID: | FBgn0051988 |
Length: | 178 |
Species: | Drosophila melanogaster |
Alignment Length: | 107 |
Identity: | 19/107 - (17%) |
Similarity: | 26/107 - (24%) |
Gaps: | 52/107 - (48%) |
- Green bases have known domain annotations that are detailed below.
Fly 518 DCFAEDCGGDSSSHQVEFEVVRPQTVTMTMTCTLPYGGPDAGHTTFQADDFNAIPSAAEDSECSI 582
|||. ||| .|..|. |..|.::.| ..|...:|.|
Fly 88 DCFC--CGG---------------------ACKKPL----ANQTFYERD---GKPYCKKDYE--- 119
Fly 583 LTTSNSPQIGFNGSSFVEADAIGSTCTYAQQDYTGSVIETHN 624
|...:.|...::..|.|.:...|
Fly 120 -------------------DLFAARCAKCEKPITDSAVLAMN 142
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1703 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.