DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and CG31988

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster


Alignment Length:107 Identity:19/107 - (17%)
Similarity:26/107 - (24%) Gaps:52/107 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   518 DCFAEDCGGDSSSHQVEFEVVRPQTVTMTMTCTLPYGGPDAGHTTFQADDFNAIPSAAEDSECSI 582
            |||.  |||                     .|..|.    |..|.::.|   ..|...:|.|   
  Fly    88 DCFC--CGG---------------------ACKKPL----ANQTFYERD---GKPYCKKDYE--- 119

  Fly   583 LTTSNSPQIGFNGSSFVEADAIGSTCTYAQQDYTGSVIETHN 624
                               |...:.|...::..|.|.:...|
  Fly   120 -------------------DLFAARCAKCEKPITDSAVLAMN 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684
CG31988NP_001286122.1 LIM 7..58 CDD:295319
LIM 66..118 CDD:295319 12/59 (20%)
LIM 126..176 CDD:259829 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.