DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Sox17

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001101372.1 Gene:Sox17 / 312936 RGDID:1305371 Length:423 Species:Rattus norvegicus


Alignment Length:98 Identity:47/98 - (47%)
Similarity:73/98 - (74%) Gaps:2/98 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 VPVNSSTPYSDATRTKKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLS 229
            |..:|..|...::|.|..|  .|:|||||||||::.||:::.::.|||||||:||.||:.|:.|:
  Rat    48 VVASSGAPAGTSSRAKAES--RIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALT 110

  Fly   230 KDDKQPYIIEAEKLRKLHMIEYPNYKYRPQKKQ 262
            ..:|:|::.|||:||..||.::|||||||::::
  Rat   111 LAEKRPFVEEAERLRVQHMQDHPNYKYRPRRRK 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 38/70 (54%)
Sox17NP_001101372.1 SOX-TCF_HMG-box 67..138 CDD:238684 38/70 (54%)
Sox17_18_mid 203..253 CDD:403331
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342392
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.