DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Sox18

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001019952.1 Gene:Sox18 / 311723 RGDID:1311718 Length:377 Species:Rattus norvegicus


Alignment Length:444 Identity:113/444 - (25%)
Similarity:169/444 - (38%) Gaps:137/444 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 AVASP-SAPVAAAAPKTPKTPE--PRSTHTHTHTHSQHFSPPPRESEMDGERSPSHSGHEMTLSM 151
            |.|.| ..||...:|.:|.:|.  |||              |||..|         ||.      
  Rat    28 AAAEPRGLPVTNVSPTSPASPSSLPRS--------------PPRSPE---------SGR------ 63

  Fly   152 DGIDSSLVFGSARVPVNSSTPYSDATRTKKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAE 216
                    :|..|    .....:|..|        |:|||||||||::.||:::.::.||||||.
  Rat    64 --------YGFGR----GERQTADELR--------IRRPMNAFMVWAKDERKRLAQQNPDLHNAV 108

  Fly   217 ISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRP-QKKQTRS----------PGSLK 270
            :||.||:.|:.|:..:|:|::.|||:||..|:.::||||||| :|||.|.          ||.::
  Rat   109 LSKMLGKAWKELNTAEKRPFVEEAERLRVQHLRDHPNYKYRPRRKKQARKVRRLEPGLLLPGLVQ 173

  Fly   271 PNQDADGCEARNDTTNNNNSLTTLAIN----GTTTAGRKSKRSTSTCQSGSAS------------ 319
            |:...:...|.:.:..:...|.||...    |..|..|.   .....:||.||            
  Rat   174 PSAPPEPFAAASGSARSFRELPTLGAEFDGLGLPTPERS---PLDGLESGEASFFPPPLAPEDCA 235

  Fly   320 -KRLRND-SGDTSSKPKYEVKMESAEQLNSADIILPSADNLISYQSSEYLPLSTLSNADCDEKLH 382
             :..|.. :.:.:..|.:......||.|.:|....|.|.          |...||.         
  Rat   236 LRAFRAPYAPELARDPSFCYGSSLAEALRTAPPAAPLAG----------LYYGTLG--------- 281

  Fly   383 SELSSGPLESRENLSEVVNRFLPLFLGGNEDSQLGVSSLTQSQHNQSDPTAGLMDNISDISPIND 447
               :.||..:            ||.......|..|...|        :|||.|..::        
  Rat   282 ---TPGPFPN------------PLSPPPEAPSLEGTEQL--------EPTADLWADV-------- 315

  Fly   448 REELTEEVMRYLPYLEVNPSSDGLTLKVESSSLLGKPLNEPVFDSEDNIVNDAN 501
              :|| |..:||......|.:..|...|..:.|..:.::.|...|..:.::||:
  Rat   316 --DLT-EFDQYLNCSRTRPDATALPYHVALAKLGPRAMSCPEESSLISALSDAS 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 36/70 (51%)
Sox18NP_001019952.1 SOX-TCF_HMG-box 78..149 CDD:238684 37/78 (47%)
Sox17_18_mid 191..239 CDD:403331 10/50 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342358
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.