DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and sox21a

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_571361.1 Gene:sox21a / 30543 ZFINID:ZDB-GENE-990715-6 Length:239 Species:Danio rerio


Alignment Length:76 Identity:45/76 - (59%)
Similarity:62/76 - (81%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 HIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIE 250
            |:|||||||||||:.:|||:....|.:||:||||.||..|:|||..:|:|:|.||::||.:||.|
Zfish     7 HVKRPMNAFMVWSRAQRRKMALDNPKMHNSEISKRLGGEWKLLSDSEKRPFIDEAKRLRAVHMKE 71

  Fly   251 YPNYKYRPQKK 261
            :|:|||||::|
Zfish    72 HPDYKYRPRRK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 41/70 (59%)
sox21aNP_571361.1 SOX-TCF_HMG-box 7..78 CDD:238684 41/70 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582396
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.