DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Cfap65

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_038940573.1 Gene:Cfap65 / 301521 -ID:- Length:1850 Species:Rattus norvegicus


Alignment Length:146 Identity:35/146 - (23%)
Similarity:56/146 - (38%) Gaps:43/146 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 NISDISPINDREELTEEVMRYL-------PYLEVNPSSDGLTLKVES-SSLLGKPLNEPVFDSED 494
            ::.|||.:...|.||.:.:.:|       .||..:|:...||.||.: .|:...|   |:|..  
  Rat  1034 SVLDISSMGSAEGLTRKHLWHLFSLDTLNSYLARDPTITELTYKVPTRHSVSHTP---PIFTP-- 1093

  Fly   495 NIVNDANLHSASHQIPPYV-------------------PDSH----DCFAEDCGGDSSS-HQVEF 535
             :..|.|..:|.|..||.|                   |...    |.:.|....:|:. ||:..
  Rat  1094 -LKLDFNFGAAPHNAPPSVVLLILKNRGLVPLDWSFLFPSDQQLDMDVWTEQADLNSTELHQMRA 1157

  Fly   536 E-----VVRPQTVTMT 546
            |     .:.|:|.::|
  Rat  1158 EDNCLFSINPKTGSLT 1173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684
Cfap65XP_038940573.1 ASH 280..>344 CDD:417311
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342378
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.