DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and sox19a

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_570983.2 Gene:sox19a / 30038 ZFINID:ZDB-GENE-980526-102 Length:297 Species:Danio rerio


Alignment Length:321 Identity:98/321 - (30%)
Similarity:150/321 - (46%) Gaps:69/321 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 ESEMDGERSPSHSGHEMTLSMDGIDSSLVFGSARVPVNSSTPYSDATRTKKHSPGHIKRPMNAFM 195
            |.:|.....|:|...:   .|..::..:..|||:..|||....|.....|      :||||||||
Zfish     6 EHDMKSAVPPTHQSAQ---GMTQLNGGVTHGSAKPAVNSQQQQSSDPMDK------VKRPMNAFM 61

  Fly   196 VWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRPQK 260
            |||:.:|||:.:..|.:||:||||.||..|:||:..:|:|:|.||::||.|||.|||:|||:|::
Zfish    62 VWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLTDAEKRPFIDEAKRLRALHMKEYPDYKYKPRR 126

  Fly   261 KQTRSPGSLKPNQDADGCEARNDTTNNNNSLTTLAINGTTTAGRKSKRSTSTCQSGSASKRLRND 325
            |       .||....|...|:. ..:..|.|...|..|                ||.:.   |.|
Zfish   127 K-------TKPVLKKDNPAAKY-PLSAGNLLAAAAAQG----------------SGGSP---RMD 164

  Fly   326 S---GDTSSKPKYEV-KMESAEQLNSADII---LPSA-------------DNLISYQSSEYLPLS 370
            |   |.|...|..:. .:..::||:..|:.   .|||             .|.:||.|:...|..
Zfish   165 SYGWGHTGGYPGMQTDALGYSQQLHRYDLSALQYPSAMATAQTYMNGANSYNPMSYSSTPQQPSP 229

  Fly   371 TLSNADCDEKLHSELSS-----GPLESRENLSEVVNRFLPLFLGG---NEDSQLGVSSLTQ 423
            .:|....::..||...:     |||:.  :|.::::.::|   ||   :..:|.|.|::.|
Zfish   230 VMSMVKPEQVSHSPTGAHSHQRGPLQG--DLRDMISMYIP---GGDTTDSGAQRGYSNIQQ 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 41/70 (59%)
sox19aNP_570983.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 12/48 (25%)
SOX-TCF_HMG-box 52..123 CDD:238684 42/76 (55%)
SOXp 122..>187 CDD:289133 19/91 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..255 9/35 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582334
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.