DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Lpxn

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_038964643.1 Gene:Lpxn / 293783 RGDID:1304981 Length:398 Species:Rattus norvegicus


Alignment Length:409 Identity:77/409 - (18%)
Similarity:124/409 - (30%) Gaps:123/409 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 DSGDTSS--------KPKYEVKME---------------SAEQLNSADIILPSADNLISYQSSEY 366
            ||.|.|:        :|..|.|:.               ..:.:.:.:|..|:..:.:.......
  Rat    30 DSEDYSNPVSCCLDQQPTQESKLPQTPKTLSTQGNTSPLKVQLVYTTNIQEPNVYSEVQEPKQSV 94

  Fly   367 LPLSTLSNADCDE------KLHSELSSGPLESRENLSEVVNR--FLPLFLGGNED--SQLGVSSL 421
            ||..|.:.|..||      :|.:::|.....||:.|.:..:.  .|...|||.|.  ..||::::
  Rat    95 LPPKTSAAAQLDELMAHLNELQAKVSVKADASRKPLPDKQDHKASLDSMLGGLEQELQDLGIATV 159

  Fly   422 TQSQHNQS--DPTAGLMDNISDIS--P-----INDREELTEEVMRYLPYLEVNP----SSDGLTL 473
            .:. |..|  .|.||.:.:....|  |     .:.:|||...     |:.|.|.    |.|...|
  Rat   160 PKG-HCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEELGSS-----PFFERNGLAYCSKDYHHL 218

  Fly   474 KVESSSLLGKPLNEPVFDSED--------------NIVNDANLHSASHQIPPYV-PDSHDCFAED 523
            .....:....|:.:.|..:.:              .:......|....:  ||. .|....|:..
  Rat   219 FSPRCAYCAAPITDKVLTAMNKTWHPEHFFCSHCGEVFGAEGFHEKDKK--PYCRKDFLAMFSPK 281

  Fly   524 CGGDSSSHQVEFEVVRPQTVTMTMTCTLPYGGPDAGHTTFQADDFNAIPSAAEDSECSILTTSNS 588
            |||                      |..|.           .:::.:..:.....||.:.....|
  Rat   282 CGG----------------------CNRPV-----------LENYLSAMNTVWHPECFVCGDCFS 313

  Fly   589 PQIGFNGSSFVEADA-----------IGSTCTYAQQDYTGSVIETHNDLNYAAHDNNGALLAYTF 642
               .|:..||.|.|.           .|:.|....|..||..|.......:..|    .:.|:..
  Rat   314 ---SFSSGSFFELDGRPFCELHYHHRRGTLCHDCGQPITGRCISAMGHKFHPEH----FVCAFCL 371

  Fly   643 EDLPPQPTGSHLEFNTNKY 661
            ..|   |.|...|.|...|
  Rat   372 TQL---PKGIFKEQNNKTY 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684
LpxnXP_038964643.1 LIM1_Leupaxin 162..216 CDD:188790 15/59 (25%)
LIM 223..274 CDD:413332 5/52 (10%)
LIM 282..334 CDD:413332 13/87 (15%)
LIM4_Paxillin_like 341..392 CDD:188725 13/54 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.