DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Sox13

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_006249824.1 Gene:Sox13 / 289026 RGDID:1309674 Length:613 Species:Rattus norvegicus


Alignment Length:474 Identity:120/474 - (25%)
Similarity:177/474 - (37%) Gaps:141/474 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PNQATTEPPLSL--RPGTVPTVPATTPARPATITIQRRHPAPKADSTPHTLPPFSPSPS-PASSP 66
            |.|....||..:  |||.....|...|.:|..:|.:     ||....|:|    |.||| ..:|.
  Rat   255 PLQLLHSPPAPVVKRPGVATHHPLQEPPQPLNLTAK-----PKVSELPNT----SSSPSLKMNSC 310

  Fly    67 SPAPAQTPGAQKTQSQAAITHPAAVASPSAPVAAAAPKTPKTPEPRSTHTHTHTHSQHF----SP 127
            .|.|:         |..|.|.....:.|:.|:.........|...:......|:||...    |.
  Rat   311 GPRPS---------SHGAPTRDLQSSPPNLPLGFLGEGDAVTKAIQDARQLLHSHSGALENSPSA 366

  Fly   128 PPRESEMDGERSPS---------HSGHEMTLSMDGIDSSLVFGSARVPVNSSTPYSDATRTKKHS 183
            |.|:..:..:.||:         |...|..|..| :|.|..|..:|   |||             
  Rat   367 PFRKDLISLDSSPAKERLEENCVHPLEEAMLGCD-VDGSRHFSESR---NSS------------- 414

  Fly   184 PGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHM 248
              ||||||||||||::.|||||.:..||:||:.|||.||.||:.::..:||||..|..:|.:.|:
  Rat   415 --HIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHL 477

  Fly   249 IEYPNYKYRPQKKQTRSPGSLKPNQDADGCEARNDTTNNNNSLTTLAINGTTTAGRKSKRSTSTC 313
            .:||:|||:|:.|:|              |                .:.|......:.|....|.
  Rat   478 EKYPDYKYKPRPKRT--------------C----------------VVEGRRLRVGEYKALMRTR 512

  Fly   314 QSGSASKRLRNDSGDTSSKPKYEVKMESAEQLNSADIILPSADNLISYQSSEYLPLSTLSNADCD 378
            :.|              ::..|.:..::.:...|:||:.|.|..         :||:.       
  Rat   513 RQG--------------ARQSYAIPPQAGQAQVSSDILFPRAAG---------MPLAR------- 547

  Fly   379 EKLHSELSSGPLESRENLSEVVNRFLPLFLGGNEDSQLGVSSL------TQSQHNQSDPTAGLMD 437
                      ||         |..:.|..|..|....:...||      |..:|:.:|   |.|.
  Rat   548 ----------PL---------VEHYDPQGLDPNMPVIINTCSLREEGEGTDDRHSVAD---GEMY 590

  Fly   438 NISDISPINDREELTEEVM 456
            ..|:.......|:..||::
  Rat   591 RYSEDEDSEGDEKSEEELV 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 39/70 (56%)
Sox13XP_006249824.1 Herpes_UL46 <251..>419 CDD:355696 50/200 (25%)
SOX-TCF_HMG-box 415..486 CDD:238684 39/70 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342382
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.