DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and matmc_1

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_595875.1 Gene:matmc_1 / 2540048 PomBaseID:SPBC1711.02 Length:181 Species:Schizosaccharomyces pombe


Alignment Length:90 Identity:27/90 - (30%)
Similarity:52/90 - (57%) Gaps:5/90 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 DATRTKKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIE 239
            |.|.|:: :|    ||.|||:::.:.:...:.:..|.::|:::||.:|..|:..||:.:..|...
pombe    96 DTTSTER-TP----RPPNAFILYRKEKHATLLKSNPSINNSQVSKLVGEMWRNESKEVRMRYFKM 155

  Fly   240 AEKLRKLHMIEYPNYKYRPQKKQTR 264
            :|..:..|...||.|||:|:|.:.:
pombe   156 SEFYKAQHQKMYPGYKYQPRKNKVK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 20/70 (29%)
matmc_1NP_595875.1 MATA_HMG-box 102..178 CDD:238685 24/80 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.