DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and mat1-Mc

DIOPT Version :10

Sequence 1:NP_476894.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_595867.1 Gene:mat1-Mc / 2539619 PomBaseID:SPBC23G7.09 Length:181 Species:Schizosaccharomyces pombe


Alignment Length:90 Identity:27/90 - (30%)
Similarity:52/90 - (57%) Gaps:5/90 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 DATRTKKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIE 239
            |.|.|:: :|    ||.|||:::.:.:...:.:..|.::|:::||.:|..|:..||:.:..|...
pombe    96 DTTSTER-TP----RPPNAFILYRKEKHATLLKSNPSINNSQVSKLVGEMWRNESKEVRMRYFKM 155

  Fly   240 AEKLRKLHMIEYPNYKYRPQKKQTR 264
            :|..:..|...||.|||:|:|.:.:
pombe   156 SEFYKAQHQKMYPGYKYQPRKNKVK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_476894.1 HMG-box_SoxC 186..261 CDD:438838 22/74 (30%)
mat1-McNP_595867.1 HMG-box_ROX1-like 104..174 CDD:438791 22/73 (30%)

Return to query results.
Submit another query.