DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Pdlim4

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001380800.1 Gene:Pdlim4 / 24915 RGDID:3575 Length:335 Species:Rattus norvegicus


Alignment Length:305 Identity:63/305 - (20%)
Similarity:109/305 - (35%) Gaps:65/305 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TITIQRRHPAP--------KADSTPHTLPPFSPSPSPASSPSPAPAQTPG----AQKTQSQAAIT 86
            |.::..|.|:|        :..|.|.|:     |...|.|.:...|..||    |...:|...:|
  Rat     2 THSVTLRGPSPWGFRLVGGRDFSAPLTI-----SRVHAGSKAALAALCPGDLIQAINGESTELMT 61

  Fly    87 HPAAV-----ASPSAPVAAAAPKT---PKTPEPRSTHTHTHTHSQHFSPPPRESEM-DG----ER 138
            |..|.     ......::.:.|:.   |.:|:.::     ..|..|..|..:.|.: ||    .|
  Rat    62 HLEAQNRIKGCHDHLTLSVSRPENKNWPSSPDDKA-----QAHRIHIDPEAQASLLQDGSPATSR 121

  Fly   139 SPSHSGHEMTLSMDGIDSSLVFGS-ARVPVNSSTPYSDATRTKKHSPGHIKRPMNAFMVWSQMER 202
            ..|.||..:..:..|:.|.  :|. .|:||..:...::.|...:.|..|:..|.:|         
  Rat   122 RSSISGISLEDNRSGLGSP--YGQPPRLPVPHNGSSNEVTLPSQMSALHVSPPPSA--------- 175

  Fly   203 RKICERTPDL--HNAEISKELGRRWQLLSKDDKQPYIIEAEK---LRKLH-MIEYPNYKYRPQKK 261
                 .||.:  .|.:...:||.....:.::..:|...|.::   .|.|. |:|......||...
  Rat   176 -----DTPRILPRNRDCRVDLGSEVYRMLREPAEPAASEPKQSGSFRYLQGMLEAGEGGDRPGSG 235

  Fly   262 QTRS--PGSLKPNQDADGCEARNDTTNNNNSLTTLAINGTTTAGR 304
            .:|:  |.:.|......|.:...:.|...:.:.     ||....|
  Rat   236 GSRNLKPAASKLGAPLSGLQGLPECTRCGHGIV-----GTIVKAR 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 14/76 (18%)
Pdlim4NP_001380800.1 PDZ_signaling 2..80 CDD:238492 18/82 (22%)
DUF4749 139..235 CDD:406377 23/111 (21%)
LIM_RIL 260..312 CDD:188835 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.