DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Sry

DIOPT Version :10

Sequence 1:NP_476894.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_035694.1 Gene:Sry / 21674 MGIID:98660 Length:395 Species:Mus musculus


Alignment Length:89 Identity:45/89 - (50%)
Similarity:67/89 - (75%) Gaps:2/89 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 GHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMI 249
            ||:|||||||||||:.||.|:.::.|.:.|.||||:||.||:.|::.:|:|:..||::|:.||..
Mouse     3 GHVKRPMNAFMVWSRGERHKLAQQNPSMQNTEISKQLGCRWKSLTEAEKRPFFQEAQRLKILHRE 67

  Fly   250 EYPNYKYRPQK--KQTRSPGSLKP 271
            :||||||:|.:  |.::..|.|:|
Mouse    68 KYPNYKYQPHRRAKVSQRSGILQP 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_476894.1 HMG-box_SoxC 186..261 CDD:438838 40/76 (53%)
SryNP_035694.1 Sufficient for interaction with KPNB1. /evidence=ECO:0000250|UniProtKB:Q05066 4..81 40/76 (53%)
HMG-box_SoxA_SoxB_SoxG 4..79 CDD:438837 40/74 (54%)
Required for nuclear localization. /evidence=ECO:0000250|UniProtKB:Q05066 6..22 13/15 (87%)
Sufficient for interaction with EP300. /evidence=ECO:0000250|UniProtKB:Q05066 52..84 14/31 (45%)
Required for nuclear localization. /evidence=ECO:0000250|UniProtKB:Q05066 75..81 1/5 (20%)
Necessary for interaction with ZNF208 isoform KRAB-O. /evidence=ECO:0000269|PubMed:15469996 92..144 45/89 (51%)
Necessary for interaction with SLC9A3R2 and nuclear accumulation of SLC9A3R2. /evidence=ECO:0000269|PubMed:16166090 94..138
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..361
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.