DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Sox14 and Sry

DIOPT Version :9

Sequence 1:	NP_001286801.1	Gene:	Sox14 / 37822	FlyBaseID:	FBgn0005612	Length:	669	Species:	Drosophila melanogaster
Sequence 2:	NP_035694.1	Gene:	Sry / 21674	MGIID:	98660	Length:	395	Species:	Mus musculus

Alignment Length:	89	Identity:	45/89 - (50%)
Similarity:	67/89 - (75%)	Gaps:	2/89 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   185 GHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMI 249
            ||:|||||||||||:.||.|:.::.|.:.|.||||:||.||:.|::.:|:|:..||::|:.||..
Mouse     3 GHVKRPMNAFMVWSRGERHKLAQQNPSMQNTEISKQLGCRWKSLTEAEKRPFFQEAQRLKILHRE 67

  Fly   250 EYPNYKYRPQK--KQTRSPGSLKP 271
            :||||||:|.:  |.::..|.|:|
Mouse    68 KYPNYKYQPHRRAKVSQRSGILQP 91

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Sox14	NP_001286801.1	SOX-TCF_HMG-box	186..257	CDD:238684	38/70 (54%)
Sry	NP_035694.1	Sufficient for interaction with KPNB1. /evidence=ECO:0000250\|UniProtKB:Q05066	4..81		40/76 (53%)
		SOX-TCF_HMG-box	4..74	CDD:238684	37/69 (54%)
		Required for nuclear localization. /evidence=ECO:0000250\|UniProtKB:Q05066	6..22		13/15 (87%)
		Sufficient for interaction with EP300. /evidence=ECO:0000250\|UniProtKB:Q05066	52..84		14/31 (45%)
		Required for nuclear localization. /evidence=ECO:0000250\|UniProtKB:Q05066	75..81		1/5 (20%)
		Necessary for interaction with ZNF208 isoform KRAB-O. /evidence=ECO:0000269\|PubMed:15469996	92..144		45/89 (51%)
		Necessary for interaction with SLC9A3R2 and nuclear accumulation of SLC9A3R2. /evidence=ECO:0000269\|PubMed:16166090	94..138
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	142..361
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167838580
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0527
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000028
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR10270
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	5	4.840