DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Pdlim2

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001240665.1 Gene:Pdlim2 / 213019 MGIID:2384850 Length:349 Species:Mus musculus


Alignment Length:124 Identity:32/124 - (25%)
Similarity:42/124 - (33%) Gaps:22/124 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RRHPAPKADSTPHTLPPFSPSPSPASSPSPAPAQTPGAQKTQSQAAITHPAAVASPSAPVAAAAP 103
            |.|...::........|.|.||.|.|..|..|..:|.|...:.....:..:...||.  :|||  
Mouse   109 RTHRDSQSSQRSACFSPVSLSPRPCSPFSTPPPTSPVALSKEDMIGCSFQSLTHSPG--LAAA-- 169

  Fly   104 KTPKTPEPRSTHTHTHTHSQHFSPPPRESEMDGERSPSHSGHEMTLSMDGIDSSLVFGS 162
                         |..|:..|     ..|:..|..|||.|...:.|...|..||..|.|
Mouse   170 -------------HHLTYPGH-----PTSQQAGHSSPSDSAVRVLLHSPGRPSSPRFSS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684
Pdlim2NP_001240665.1 PDZ_signaling 9..80 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..147 11/37 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..212 16/62 (26%)
DUF4749 <198..252 CDD:406377 5/13 (38%)
LIM_Mystique 283..335 CDD:188833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.