DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Sox7

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_035576.1 Gene:Sox7 / 20680 MGIID:98369 Length:380 Species:Mus musculus


Alignment Length:369 Identity:100/369 - (27%)
Similarity:143/369 - (38%) Gaps:104/369 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 KHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRK 245
            |.|...|:|||||||||::.||:::..:.|||||||:||.||:.|:.|:...|:||:.|||:||.
Mouse    39 KSSESRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALTLSQKRPYVDEAERLRL 103

  Fly   246 LHMIEYPNYKYRP-QKKQTR------SPGSLKPNQDADGCEARNDTTNNNNSLTTLAINGTTTAG 303
            .||.:|||||||| :|||.:      .||.|..:...|     .:|....|.:           |
Mouse   104 QHMQDYPNYKYRPRRKKQGKRLCKRVDPGFLLSSLSRD-----QNTLPEKNGI-----------G 152

  Fly   304 RKSKRSTSTCQSGSASKRLRN----------DSGDTSSKPKYEVKMESAEQLNSADIILPSADNL 358
            |..|........|:....|.:          .|.||     |...:.:..:::..|.:.|.    
Mouse   153 RGEKEDRGEYSPGATLPGLHSCYREGAAAAPGSVDT-----YPYGLPTPPEMSPLDALEPE---- 208

  Fly   359 ISYQSSEYLPLSTLSNADCDEK----LHSELSSGPLESRENLSEVVNRFLPLFLGGNEDSQLGVS 419
                       .|..::.|.|:    .|.....||..|.|        |.|..|  :....||..
Mouse   209 -----------QTFFSSSCQEEHGHPHHLPHLPGPPYSPE--------FTPSPL--HCSHPLGSL 252

  Fly   420 SLTQSQHNQSDPTAGLMDNISDISPINDREELTEEVMRYLPYLEVNPSSDGLTLKVESSSLLGKP 484
            :|.||      |...:|.::|...|          ...|..:...:|....|...:   ..|..|
Mouse   253 ALGQS------PGVSMMSSVSGCPP----------SPAYYSHATYHPLHPNLQAHL---GQLSPP 298

  Fly   485 LNEPVFDSEDNIVN------------DANLHSASHQIPPYVPDS 516
            ...|.||:.|.:..            |..|::..|      |||
Mouse   299 PEHPGFDTLDQLSQVELLGDMDRNEFDQYLNTPGH------PDS 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 40/70 (57%)
Sox7NP_035576.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..43 2/3 (67%)
SOX-TCF_HMG-box 44..115 CDD:238684 40/70 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..167 7/43 (16%)
Sox_C_TAD 175..378 CDD:288887 41/217 (19%)
Required for beta-catenin-binding 323..328 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838584
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.