DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Sox5

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_006506994.1 Gene:Sox5 / 20678 MGIID:98367 Length:792 Species:Mus musculus


Alignment Length:464 Identity:118/464 - (25%)
Similarity:166/464 - (35%) Gaps:163/464 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PLSLRPGTVPTVPATTP-------------------------------------ARPATITIQR- 39
            |:.|.|.|:....|.||                                     ..|.:|...: 
Mouse   344 PVQLIPTTMAAAAAATPGLGPLQLQQFYAAQLAAMQVSPGGKLLGLPQGNLGAAVSPTSIHTDKS 408

  Fly    40 -RHPAPKA-DSTPHTL-----PPFSPSPSPASSPSP-APAQTPGAQKTQSQAAITHPAAVASPSA 96
             ..|.||: |.....|     |..|...||||..|| .||....:.....:|::  |||:|||||
Mouse   409 TNSPPPKSKDEVAQPLNLSAKPKTSDGKSPASPTSPHMPALRINSGAGPLKASV--PAALASPSA 471

  Fly    97 PVAAAA------PKTPKTPEPRSTHTHTHTHSQHFSPPPRESEMDG------------------- 136
            .|:...      ..|....|.|..........|         .:||                   
Mouse   472 RVSTIGYLNDHDAVTKAIQEARQMKEQLRREQQ---------ALDGKVAVVNSIGLSNCRTEKEK 527

  Fly   137 ----------------ERSPSHSGHEMTLSMDGIDSSLVFGSARVPVNSSTPYSDATRTKKHSPG 185
                            |...||.  .|..:|.| ||.   |||  .|:.|..|.::.....:.| 
Mouse   528 TTLESLTQQLAVKQNEEGKFSHG--MMDFNMSG-DSD---GSA--GVSESRIYRESRGRGSNEP- 583

  Fly   186 HIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIE 250
            ||||||||||||::.|||||.:..||:||:.|||.||.||:.::..:||||..|..:|.|.|:.:
Mouse   584 HIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHLEK 648

  Fly   251 YPNYKYRPQKKQTRSPGSLKPNQDADGCEARNDTTNNNNSLTTLAINGTTTAGRKSKRSTSTCQS 315
            ||:|||:|:.|:|              |                     ...|:|       .:.
Mouse   649 YPDYKYKPRPKRT--------------C---------------------LVDGKK-------LRI 671

  Fly   316 GSASKRLRNDSGDTSSKPKYEVKMESAEQLNSADIILPSADNLISYQSSEYLPLSTLSNADCDEK 380
            |.....:||...:  .:..:.|..::...:.:|.::.|||..:.. ..|.:||..          
Mouse   672 GEYKAIMRNRRQE--MRQYFNVGQQAQIPIATAGVVYPSAIAMAG-MPSPHLPSE---------- 723

  Fly   381 LHSELSSGP 389
             ||.:||.|
Mouse   724 -HSSVSSSP 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 40/70 (57%)
Sox5XP_006506994.1 SOX-TCF_HMG-box 584..655 CDD:238684 40/70 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838606
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.