DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Sox3

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_033263.2 Gene:Sox3 / 20675 MGIID:98365 Length:450 Species:Mus musculus


Alignment Length:276 Identity:85/276 - (30%)
Similarity:117/276 - (42%) Gaps:97/276 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PTVPA-----TTPAR-PATITIQRRHPAPKADSTPHTLPPFSPSP-----------SPASSPSPA 69
            |.:||     |||.. |...|:..  |||.|.|.|.||....|:|           :|...|:||
Mouse    32 PELPARRPLSTTPTESPGLFTVAA--PAPGAPSPPATLAHLLPAPAMYSLLETELKNPVGPPTPA 94

  Fly    70 PAQTPGAQKTQSQAAITHPAAVASPSAPVAAAAPKTPKTPEPRSTHTHTHTHSQHFSPPPRESEM 134
                               |....|:||  .||.|:...|                         
Mouse    95 -------------------AGTGVPAAP--GAAGKSGANP------------------------- 113

  Fly   135 DGERSPSHSGHEMTLSMDGIDSSLVFGSARVPVNSSTPYSDATRTKKHSPGHIKRPMNAFMVWSQ 199
               ...:::|:..:...:|.......|.           ||..|        :|||||||||||:
Mouse   114 ---AGGANAGNGGSGGANGGGGGGGGGG-----------SDQDR--------VKRPMNAFMVWSR 156

  Fly   200 MERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRPQKKQTR 264
            .:|||:....|.:||:||||.||..|:||:..:|:|:|.||::||.:||.|||:|||||::| |:
Mouse   157 GQRRKMALENPKMHNSEISKRLGADWKLLTDAEKRPFIDEAKRLRAVHMKEYPDYKYRPRRK-TK 220

  Fly   265 S---------PGSLKP 271
            :         ||.|.|
Mouse   221 TLLKKDKYSLPGGLLP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 40/70 (57%)
Sox3NP_033263.2 SOX-TCF_HMG-box 143..214 CDD:238684 41/78 (53%)
SOXp 213..306 CDD:289133 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838558
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.