DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Sox2

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_035573.3 Gene:Sox2 / 20674 MGIID:98364 Length:319 Species:Mus musculus


Alignment Length:299 Identity:92/299 - (30%)
Similarity:139/299 - (46%) Gaps:63/299 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLR 244
            :|:||..:|||||||||||:.:|||:.:..|.:||:||||.||..|:|||:.:|:|:|.||::||
Mouse    36 QKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLR 100

  Fly   245 KLHMIEYPNYKYRPQK---------KQTRSPGSLKP-------------------NQDADGCEAR 281
            .|||.|:|:|||||::         |.|...|.|.|                   ||..|.....
Mouse   101 ALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHM 165

  Fly   282 NDTTNNNNSLTT----------LAINGTTTAGRKSKRSTSTCQ--SGSASKRLRNDSGDTSSKPK 334
            |..:|.:.|:..          |..:|........:...|..|  |.::|:...|.|      |.
Mouse   166 NGWSNGSYSMMQEQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGS------PT 224

  Fly   335 YEVKMESAEQLNSADIILPSADNLISYQSSEYLPLSTLSNADCDEKLHSELSSGPLESRENLSEV 399
            |.:   |..|..:..:.|.|..:::..::|...|:.|.|:       ||.   .|.::.: |.::
Mouse   225 YSM---SYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSS-------HSR---APCQAGD-LRDM 275

  Fly   400 VNRFLPLFLGGNEDSQLGVSSLTQSQHNQSDPTAGLMDN 438
            ::.:||   |.........|.|..:||.||.|..|...|
Mouse   276 ISMYLP---GAEVPEPAAPSRLHMAQHYQSGPVPGTAIN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 41/70 (59%)
Sox2NP_035573.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 3/6 (50%)
SOX-TCF_HMG-box 42..113 CDD:238684 41/70 (59%)
SOXp 112..202 CDD:403523 16/89 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..267 6/29 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..319 6/13 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838608
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.