DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Sox18

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_033262.2 Gene:Sox18 / 20672 MGIID:103559 Length:377 Species:Mus musculus


Alignment Length:219 Identity:70/219 - (31%)
Similarity:104/219 - (47%) Gaps:62/219 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 AAVASPSAPVAAAAPKTPKTPE--PRSTHTHTHTHSQHFSPPPRESEMDGERSPSHSGHEMTLSM 151
            ||..:...||...:|.:|.:|.  |||              |||..|         ||.      
Mouse    28 AAAEARGLPVTNVSPTSPASPSSLPRS--------------PPRSPE---------SGR------ 63

  Fly   152 DGIDSSLVFGSARVPVNSSTPYSDATRTKKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAE 216
                    :|..|    .....:|..|        |:|||||||||::.||:::.::.||||||.
Mouse    64 --------YGFGR----GERQTADELR--------IRRPMNAFMVWAKDERKRLAQQNPDLHNAV 108

  Fly   217 ISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRP-QKKQTRS----------PGSLK 270
            :||.||:.|:.|:..:|:|::.|||:||..|:.::||||||| :|||.|.          ||.::
Mouse   109 LSKMLGKAWKELNTAEKRPFVEEAERLRVQHLRDHPNYKYRPRRKKQARKVRRLEPGLLLPGLVQ 173

  Fly   271 PNQDADGCEARNDTTNNNNSLTTL 294
            |:...:...|.:.:..:...|.||
Mouse   174 PSAPPEAFAAASGSARSFRELPTL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 36/70 (51%)
Sox18NP_033262.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76 18/88 (20%)
SOX-TCF_HMG-box 78..149 CDD:238684 37/78 (47%)
Interaction with DNA. /evidence=ECO:0000269|PubMed:26939885 81..94 9/12 (75%)
Interaction with DNA. /evidence=ECO:0000269|PubMed:26939885 105..117 7/11 (64%)
Important for transcriptional activation. /evidence=ECO:0000269|PubMed:10742113, ECO:0000269|PubMed:7651823 160..225 7/38 (18%)
Sox_C_TAD 187..375 CDD:288887 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838564
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.