DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Sox17

DIOPT Version :10

Sequence 1:NP_476894.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_035571.1 Gene:Sox17 / 20671 MGIID:107543 Length:419 Species:Mus musculus


Alignment Length:98 Identity:47/98 - (47%)
Similarity:72/98 - (73%) Gaps:2/98 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 VPVNSSTPYSDATRTKKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLS 229
            |..:|..|...:.|.|..|  .|:|||||||||::.||:::.::.|||||||:||.||:.|:.|:
Mouse    48 VVASSGAPAGTSGRAKAES--RIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALT 110

  Fly   230 KDDKQPYIIEAEKLRKLHMIEYPNYKYRPQKKQ 262
            ..:|:|::.|||:||..||.::|||||||::::
Mouse   111 LAEKRPFVEEAERLRVQHMQDHPNYKYRPRRRK 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_476894.1 HMG-box_SoxC 186..261 CDD:438838 41/74 (55%)
Sox17NP_035571.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
HMG-box_SoxF_SOX17 62..142 CDD:438850 43/81 (53%)
Sox17_18_mid 203..253 CDD:463454
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..356
9aaTAD. /evidence=ECO:0000250|UniProtKB:Q9H6I2 366..374
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.