DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Sox15

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_033261.1 Gene:Sox15 / 20670 MGIID:98363 Length:231 Species:Mus musculus


Alignment Length:218 Identity:66/218 - (30%)
Similarity:111/218 - (50%) Gaps:40/218 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 SSTPYSDATRTKKHSPG--------HIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRW 225
            :|.|.....:....|||        .:|||||||||||.::||::.::.|.:||:||||.||.:|
Mouse    21 ASLPLGPQEQEAGGSPGASGGLPLEKVKRPMNAFMVWSSVQRRQMAQQNPKMHNSEISKRLGAQW 85

  Fly   226 QLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRPQKK-QTRSPGSLKPNQDADGCEARNDTTNNNN 289
            :||..::|:|::.||::||..|:.:||:|||||::| :..|.||:..:|:..|            
Mouse    86 KLLGDEEKRPFVEEAKRLRARHLRDYPDYKYRPRRKSKNSSTGSVPFSQEGGG------------ 138

  Fly   290 SLTTLAING-------TTTAGRKS------KRSTSTCQSGSASKRLRNDSGDTSSKPKYEVKMES 341
                ||..|       |||.|.:.      ..||:.......|...|.::....:.|:.:.:::.
Mouse   139 ----LACGGSHWGPGYTTTQGSRGFGYQPPNYSTAYLPGSYTSSHCRPEAPLPCTFPQSDPRLQG 199

  Fly   342 AEQLNSADIILPSADNLISYQSS 364
            ..:.:.:..:.|  |:...|.:|
Mouse   200 ELRPSFSPYLSP--DSSTPYNTS 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 36/70 (51%)
Sox15NP_033261.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 5/23 (22%)
Required to promote HAND1 transcriptional activator activity. /evidence=ECO:0000269|PubMed:16759287 1..45 5/23 (22%)
SOX-TCF_HMG-box 46..117 CDD:238684 36/70 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..136 12/24 (50%)
Interaction with FHL3. /evidence=ECO:0000269|PubMed:17363903 136..181 11/60 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..231 5/37 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838592
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.