DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Sox11

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_033260.4 Gene:Sox11 / 20666 MGIID:98359 Length:395 Species:Mus musculus


Alignment Length:430 Identity:125/430 - (29%)
Similarity:178/430 - (41%) Gaps:120/430 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 EMTLSMDGIDS--SLVFGSARVPVNSSTPYSDATRTKKHSPGHIKRPMNAFMVWSQMERRKICER 208
            |..|..|.:|:  ......:.|.::.|.|  |..:|   :.||||||||||||||::|||||.|:
Mouse    11 ESNLPRDALDTEEGEFMACSPVALDESDP--DWCKT---ASGHIKRPMNAFMVWSKIERRKIMEQ 70

  Fly   209 TPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRPQKKQTRSPGS----- 268
            :||:|||||||.||:||::|...:|.|:|.|||:||..||.:||:|||||:||....|.:     
Mouse    71 SPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKTDPAAKPSAG 135

  Fly   269 LKPNQDADGCEARNDTTNNNNSLTTLAINGTTTAGRKSKRSTSTCQSGSASKRLRNDSGDTSSKP 333
            ..|::.|.|.:|..........|...|  |...||:.::  ...|.:|.|:|.:..|..|.....
Mouse   136 QSPDKSAAGAKAAKGPGKKCAKLKAPA--GKAGAGKAAQ--PGDCAAGKAAKCVFLDDDDEDDDE 196

  Fly   334 KYEVKMESAEQLNSADIILPSADNLISYQSSEYLPLSTLSNADCDEKLHSELSSGPLESRENLSE 398
            ..|:::...          |.||:                  |.||..||.|...|  :::...:
Mouse   197 DDELQLRPK----------PDADD------------------DDDEPAHSHLLPPP--TQQQPPQ 231

  Fly   399 VVNRF----LPLFLGGNEDSQLGVSSLTQSQHNQSDPTAGLMD-------------NISD----- 441
            ::.|:    :|             :|.|.|...:|...|.|.|             ||:.     
Mouse   232 LLRRYSVAKVP-------------ASPTLSSAAESPEGASLYDEVRAGGRLYYSFKNITKQQPPP 283

  Fly   442 ----ISPINDREELTEEVMRYLPYLEVNPSSDGLTLKVESSSLLGKPLNEPVFDSEDNIVNDANL 502
                :||.:.|...|.             ||.|     .||....:..::.:||...|....|  
Mouse   284 APPALSPASSRCVSTS-------------SSSG-----SSSGSGAEDADDLMFDLSLNFSQGA-- 328

  Fly   503 HSASHQIP-----------PYVPDSHDCFAEDCGGDSSSH 531
            |||..| |           ..|....|.|:|   |...||
Mouse   329 HSACEQ-PLGAGAAGNLSLSLVDKDLDSFSE---GSLGSH 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 47/70 (67%)
Sox11NP_033260.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 4/10 (40%)
SOX-TCF_HMG-box 48..119 CDD:238684 47/70 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..258 41/190 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..312 10/53 (19%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000269|PubMed:18403418 363..395 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838600
Domainoid 1 1.000 109 1.000 Domainoid score I6352
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 1 1.000 - - otm42653
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.