DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Sox1

DIOPT Version :10

Sequence 1:NP_476894.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_033259.2 Gene:Sox1 / 20664 MGIID:98357 Length:391 Species:Mus musculus


Alignment Length:112 Identity:50/112 - (44%)
Similarity:72/112 - (64%) Gaps:11/112 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 GSARVPVNSSTPY-----------SDATRTKKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHN 214
            |.|:.|.|.|.|.           .......|.:...:|||||||||||:.:|||:.:..|.:||
Mouse    14 GGAQAPTNLSGPAGAGGGGGGGGGGGGGGGTKANQDRVKRPMNAFMVWSRGQRRKMAQENPKMHN 78

  Fly   215 AEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRPQKK 261
            :||||.||..|:::|:.:|:|:|.||::||.|||.|:|:|||||::|
Mouse    79 SEISKRLGAEWKVMSEAEKRPFIDEAKRLRALHMKEHPDYKYRPRRK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_476894.1 HMG-box_SoxC 186..261 CDD:438838 42/74 (57%)
Sox1NP_033259.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 7/37 (19%)
HMG-box_SoxB 49..128 CDD:438790 43/77 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..249
9aaTAD. /evidence=ECO:0000250|UniProtKB:P41225 342..350
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.