DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and sox-3

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_510439.1 Gene:sox-3 / 185534 WormBaseID:WBGene00004950 Length:212 Species:Caenorhabditis elegans


Alignment Length:124 Identity:54/124 - (43%)
Similarity:77/124 - (62%) Gaps:13/124 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 DSSLVFGSARVPVNSSTPYSDATRTKKHS---PG----------HIKRPMNAFMVWSQMERRKIC 206
            |.|.::.|......:.|.|.:.|.:....   ||          |:|||||||||||:.:|||:.
 Worm     3 DLSCLYPSLLCTEAAKTSYDEDTTSVSSGLSPPGSPVDLQNSLDHVKRPMNAFMVWSRGQRRKMA 67

  Fly   207 ERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRPQKKQTRS 265
            :..|.:||:||||.||..|:.||:.:|:|:|.||::||.|||.|:|:|||||::|...|
 Worm    68 QDNPKMHNSEISKRLGAEWKQLSEQEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKSS 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 41/70 (59%)
sox-3NP_510439.1 SOX-TCF_HMG-box 47..118 CDD:238684 41/70 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160176
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1275
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.