DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and sox-4

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001335567.1 Gene:sox-4 / 182547 WormBaseID:WBGene00015716 Length:260 Species:Caenorhabditis elegans


Alignment Length:226 Identity:71/226 - (31%)
Similarity:108/226 - (47%) Gaps:29/226 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SQAAITHP-AAVASPSAPVAAAAPKTPKTPEPRSTHTHTHTHSQHFSPPPRESEMDGERSPS--H 142
            |||..|.| ||.:|.|.|:  .:|....|.:..:......:..|       .::.||..|||  .
 Worm    14 SQARKTTPIAAASSVSCPI--VSPNMDATQKLLAIMATVKSFEQ-------VNDSDGLSSPSSPE 69

  Fly   143 SGHEMTLSMDGIDSSLVF---------GSARVPVNSSTPYSDATRTKKHSPGHIKRPMNAFMVWS 198
            |..|....:..:.:|.:.         .|.:..||||...:...||.:..  .||||||||||||
 Worm    70 SPTESPNVISSVQASTIADIIGHYVNGNSIKDVVNSSQKSASQPRTAREP--RIKRPMNAFMVWS 132

  Fly   199 QMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRP--QKK 261
            |..|::|.......||::|||.||..|:.:.:.:|.|::..|::||:.|...:|:|.|||  :|:
 Worm   133 QQRRQQIAATGQKFHNSDISKMLGAEWRKMEEHEKVPFVERAKQLREEHFNAHPDYVYRPRRRKR 197

  Fly   262 QTRSPGSLKPNQDADGCEARNDTTNNNNSLT 292
            ..:|.||:    |::..:......|..||.|
 Worm   198 VEKSAGSV----DSNSADEITKPVNVYNSST 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 31/70 (44%)
sox-4NP_001335567.1 SOX-TCF_HMG-box 120..191 CDD:238684 31/70 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160173
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.