DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and sox-2

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_741836.1 Gene:sox-2 / 181002 WormBaseID:WBGene00004949 Length:283 Species:Caenorhabditis elegans


Alignment Length:337 Identity:85/337 - (25%)
Similarity:135/337 - (40%) Gaps:90/337 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 DGERSPSHSGHEMTLSMDGIDSSLVFGSARVPVNSSTPYS-DAT-RTKKHSPGHIKRPMNAFMVW 197
            |..:...:||......|....|:.:...:.....|:.|.| |:| :..|.:...:||||||||||
 Worm     6 DSAKMQDYSGWSFGFHMPPTSSTNLLPQSMPDDLSNGPDSPDSTGKDGKKNDDRVKRPMNAFMVW 70

  Fly   198 SQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIEYPNYKYRPQKKQ 262
            |:.:|:|:....|.:||:||||.||..|::||:.:|:|:|.||::||.:||.|:|:|||||::| 
 Worm    71 SRGQRKKMALENPKMHNSEISKRLGTEWKMLSEQEKRPFIDEAKRLRAIHMKEHPDYKYRPRRK- 134

  Fly   263 TRSPGSLKPNQDADGCEARNDTTNNNNSLTTLAINGTTTAGRKSKRSTSTCQSGSASKRLRNDSG 327
                                          |.:||         |::.:....|:...:      
 Worm   135 ------------------------------TKSIN---------KKNGAPIPFGNLDTK------ 154

  Fly   328 DTSSKPKYEVKMESAEQLNSADIILPSADNLISYQSSEYLPLS---TLSNADCDEKLHSELSSGP 389
             |.|.|.......:..|........|.....:..|    :|.|   .:.:...|....|:....|
 Worm   155 -TPSYPTLTTNWNATNQYIDQFRFAPYPTTTVMDQ----IPFSLTYPVHSVPTDNSSPSQFQPSP 214

  Fly   390 LESRENLSEVVNRFLPLFLGG-----NEDSQLGVSSLTQSQHNQSDPTAGLMDNISDISPINDRE 449
            :.:.             |.|.     :|.|.:|           ||.|.|.:|:    |......
 Worm   215 MSTN-------------FAGSYLTPKSESSPVG-----------SDSTVGTVDS----SQFRAYY 251

  Fly   450 ELTEEVMRYLPY 461
            :.|::.|.| ||
 Worm   252 DHTKDQMMY-PY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 38/70 (54%)
sox-2NP_741836.1 SOX-TCF_HMG-box 59..130 CDD:238684 38/70 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.