DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Sox5

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_006237666.1 Gene:Sox5 / 140587 RGDID:620471 Length:764 Species:Rattus norvegicus


Alignment Length:444 Identity:119/444 - (26%)
Similarity:162/444 - (36%) Gaps:133/444 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PLSLRPGTVPTVPATTP-------------------------------------ARPATITIQR- 39
            |:.|.|.|:....|.||                                     ..|.:|...: 
  Rat   316 PVQLIPTTMAAAAAATPGLGPLQLQQFYAAQLAAMQVSPGGKLLGLPQGNLGAAVSPTSIHTDKS 380

  Fly    40 -RHPAPKA-DSTPHTL-----PPFSPSPSPASSPSP-APAQTPGAQKTQSQAAITHPAAVASPSA 96
             ..|.||: |.....|     |..|...||||..|| .||....:.....:|::  |||:|||||
  Rat   381 TNSPPPKSKDEVAQPLNLSAKPKTSDGKSPASPTSPHMPALRINSGAGPLKASV--PAALASPSA 443

  Fly    97 PVAAAA------PKTPKTPEPRSTHTHTHTHSQHFSPPPRESEMDG------------------- 136
            .|:...      ..|....|.|..........|         .:||                   
  Rat   444 RVSTIGYLNDHDAVTKAIQEARQMKEQLRREQQ---------ALDGKVAVVNSIGISNCRTEKEK 499

  Fly   137 ----------------ERSPSHSGHEMTLSMDGIDSSLVFGSARVPVNSSTPYSDATRTKKHSPG 185
                            |...||.  .|..:|.| ||.   |||  .|:.|..|.::.....:.| 
  Rat   500 TTLESLTQQLAVKQNEEGKFSHG--MMDFNMSG-DSD---GSA--GVSESRIYRESRGRGSNEP- 555

  Fly   186 HIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIE 250
            ||||||||||||::.|||||.:..||:||:.|||.||.||:.::..:||||..|..:|.|.|:.:
  Rat   556 HIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHLEK 620

  Fly   251 YPNYKYRPQKKQT-------RSPGSLKPNQDADGCEARNDTTNNNNSLTTLAINGTTTAGRKSKR 308
            ||:|||:|:.|:|       ...|..|........|.|........:...:|..|....|     
  Rat   621 YPDYKYKPRPKRTCLVDGKKLRIGEYKAIMRNRRQEMRQYFNVGQQAQIPIATAGVVYPG----- 680

  Fly   309 STSTCQSGSASKRLRNDSGDTSSKPK---------YEVKMES---AEQLNSADI 350
              :...:|..|..|.::....||.|:         |.||.|.   .|::.:.||
  Rat   681 --AIAMAGMPSPHLPSEHSSVSSSPEPGMPVIQSTYGVKGEEPHIKEEIQAEDI 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 40/70 (57%)
Sox5XP_006237666.1 SOX-TCF_HMG-box 556..627 CDD:238684 40/70 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342394
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.