DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and LDB3

DIOPT Version :9

Sequence 1:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001165081.1 Gene:LDB3 / 11155 HGNCID:15710 Length:732 Species:Homo sapiens


Alignment Length:325 Identity:79/325 - (24%)
Similarity:111/325 - (34%) Gaps:119/325 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KPNQATTEPPLSLRPGTVPTVPATTPARPATITIQRRHPAPKADSTPHTLPPFSPSPSPASSPSP 68
            ||...||   .|:||.....|||:|.:           |:|.|:.:|   .|::|||:||.:|||
Human   399 KPRVVTT---ASIRPSVYQPVPASTYS-----------PSPGANYSP---TPYTPSPAPAYTPSP 446

  Fly    69 APAQTPGAQKTQSQAAITHPAAVASPS-APVAAAAPKT-----PKTPEPRSTHTHTHTHSQHFSP 127
            |||.||....|.:.:    ||...:|| ||....||..     |..|..|.......:.||.|:|
Human   447 APAYTPSPVPTYTPS----PAPAYTPSPAPNYNPAPSVAYSGGPAEPASRPPWVTDDSFSQKFAP 507

  Fly   128 PPRESEMDGERSPSHSGHEMTLSMDG------------IDSSLVFGSARVPVNSSTPYSDATRTK 180
                    |:.:.|.|  :.||...|            :....|..:.|.|.:|.||...     
Human   508 --------GKSTTSIS--KQTLPRGGPAYTPAGPQVPPLARGTVQRAERFPASSRTPLCG----- 557

  Fly   181 KHSPGHIKRPMNAFMV-----WS-------------------QMERRKICERTPDLHNA------ 215
             |....|:.|   |:|     |.                   :.:....|||..:...|      
Human   558 -HCNNVIRGP---FLVAMGRSWHPEEFTCAYCKTSLADVCFVEEQNNVYCERCYEQFFAPLCAKC 618

  Fly   216 ------EISKELGRRW----------------QLLSKDDKQPYIIEAEK------LRKLHMIEYP 252
                  |:...|.:.|                .|...:|.:||   .||      ..|.|..::|
Human   619 NTKIMGEVMHALRQTWHTTCFVCAACKKPFGNSLFHMEDGEPY---CEKDYINLFSTKCHGCDFP 680

  Fly   253  252
            Human   681  680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 21/125 (17%)
LDB3NP_001165081.1 PDZ_signaling 5..81 CDD:238492
DUF4045 <77..180 CDD:330572
ZM 189..214 CDD:128974
DUF4749 263..353 CDD:318205
Atrophin-1 <387..554 CDD:331285 55/185 (30%)
LIM1_ZASP_Cypher 556..607 CDD:188838 9/59 (15%)
LIM2_Enigma_like 615..666 CDD:188748 9/53 (17%)
LIM3_Enigma_like 674..727 CDD:188749 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.