Sequence 1: | NP_001286801.1 | Gene: | Sox14 / 37822 | FlyBaseID: | FBgn0005612 | Length: | 669 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001165081.1 | Gene: | LDB3 / 11155 | HGNCID: | 15710 | Length: | 732 | Species: | Homo sapiens |
Alignment Length: | 325 | Identity: | 79/325 - (24%) |
---|---|---|---|
Similarity: | 111/325 - (34%) | Gaps: | 119/325 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 KPNQATTEPPLSLRPGTVPTVPATTPARPATITIQRRHPAPKADSTPHTLPPFSPSPSPASSPSP 68
Fly 69 APAQTPGAQKTQSQAAITHPAAVASPS-APVAAAAPKT-----PKTPEPRSTHTHTHTHSQHFSP 127
Fly 128 PPRESEMDGERSPSHSGHEMTLSMDG------------IDSSLVFGSARVPVNSSTPYSDATRTK 180
Fly 181 KHSPGHIKRPMNAFMV-----WS-------------------QMERRKICERTPDLHNA------ 215
Fly 216 ------EISKELGRRW----------------QLLSKDDKQPYIIEAEK------LRKLHMIEYP 252
Fly 253 252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sox14 | NP_001286801.1 | SOX-TCF_HMG-box | 186..257 | CDD:238684 | 21/125 (17%) |
LDB3 | NP_001165081.1 | PDZ_signaling | 5..81 | CDD:238492 | |
DUF4045 | <77..180 | CDD:330572 | |||
ZM | 189..214 | CDD:128974 | |||
DUF4749 | 263..353 | CDD:318205 | |||
Atrophin-1 | <387..554 | CDD:331285 | 55/185 (30%) | ||
LIM1_ZASP_Cypher | 556..607 | CDD:188838 | 9/59 (15%) | ||
LIM2_Enigma_like | 615..666 | CDD:188748 | 9/53 (17%) | ||
LIM3_Enigma_like | 674..727 | CDD:188749 | 2/7 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1703 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |