DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Sox14 and Lpxn

DIOPT Version :9

Sequence 1:	NP_001286801.1	Gene:	Sox14 / 37822	FlyBaseID:	FBgn0005612	Length:	669	Species:	Drosophila melanogaster
Sequence 2:	NP_598913.1	Gene:	Lpxn / 107321	MGIID:	2147677	Length:	386	Species:	Mus musculus

Alignment Length:	135	Identity:	33/135 - (24%)
Similarity:	45/135 - (33%)	Gaps:	19/135 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly    47 DSTPHTLPPFSPSPSPASSPSPAPAQTPGAQKTQSQAAITHPAAV--------ASPSAPVAAAAP 103
            ||..::.|........::..|..| |||   ||.|....|.|..|        ..|:.......|
Mouse    18 DSEEYSNPVSCHLDQQSTEESKIP-QTP---KTLSSQGNTSPLKVQLVYATNIQEPNVYSEVQEP 78

  Fly   104 KTPKTPEPRSTHTHTHTHSQHFSPPPRESEMDGERS----PSHSGHEMTL-SMDG-IDSSLV-FG 161
            |....|...|..........|.|....:..:..:.|    |....|:.:| ||.| ::..|. .|
Mouse    79 KESVLPPKTSAAAQLDELMAHLSEMQAKVSVKADTSRKPLPDQQDHKASLDSMLGDLEQELQDLG 143

  Fly   162 SARVP 166
            .|.||
Mouse   144 IATVP 148

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Sox14	NP_001286801.1	SOX-TCF_HMG-box	186..257	CDD:238684
Lpxn	NP_598913.1	LD motif 1	3..15
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	19..52		10/36 (28%)
		LD motif 2	70..82		2/11 (18%)
		LD motif 3	92..103		2/10 (20%)
		LIM	150..204	CDD:295319
		LIM	211..262	CDD:295319
		LIM	270..322	CDD:295319
		LIM4_Paxillin_like	329..380	CDD:188725
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1703
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900