DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and sox14

DIOPT Version :10

Sequence 1:NP_476894.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001093703.1 Gene:sox14 / 100101715 XenbaseID:XB-GENE-485370 Length:239 Species:Xenopus tropicalis


Alignment Length:76 Identity:47/76 - (61%)
Similarity:63/76 - (82%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 HIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIE 250
            |||||||||||||:.:|||:.:..|.:||:||||.||..|:|||:.:|:|||.||::||..||.|
 Frog     7 HIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMKE 71

  Fly   251 YPNYKYRPQKK 261
            :|:|||||::|
 Frog    72 HPDYKYRPRRK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_476894.1 HMG-box_SoxC 186..261 CDD:438838 46/74 (62%)
sox14NP_001093703.1 HMG-box_SoxB 6..85 CDD:438790 47/76 (62%)
SOXp 77..>95 CDD:463537 4/6 (67%)

Return to query results.
Submit another query.